PEPS MN / KNOWLEDGE LIBRARY

MGF (Mechano Growth Factor)

Mechano Growth Factor | IGF-1 Splice Variant

Weight: ~2,888 Da

Half-life: ~5-7 minutes

Chain: 24 amino acids

2 studies

2011 latest

limited

Community Research

Join others researching MGF — share findings, ask questions, and learn from real experiences

View Results Aggregated community findings

Discussion Questions & experiences

Submit Your Findings Contribute your research data

Non-pegylated IGF-1 splice variant produced locally in muscle tissue following mechanical stress. Has a very short half-life compared to PEG-MGF, requiring more frequent administration or localized injection.

Mechanism of Action

Activates muscle satellite stem cells via receptor binding, stimulating MAPK/ERK signaling. Enhances protein synthesis and promotes muscle fiber repair. The E-peptide domain exhibits distinct activity from mature IGF-1.

01 Satellite cell activation for muscle repair

02 Recovery support following mechanical stress

03 Localized tissue regeneration

04 Natural upregulation after exercise

Molecular Data

Molecular Weight

~2,888 Da

Chain Length

24 amino acids

Type

IGF-1Ec splice variant C-terminal peptide

Amino Acid Sequence

YQPPSTNKNTKSQRRKGSTFEEHK

Complex or non-standard sequence format

Research Indications

Muscle Repair

Satellite Cell Activation most effective

Primary mechanism activating dormant muscle satellite cells which fuse to damaged fibers.

Local Muscle Recovery effective

Short half-life means effects are concentrated at injection site.

Post-Exercise Recovery effective

Naturally upregulated after mechanical stress; supplementation enhances repair processes.

Tissue Regeneration

Tendon Healing moderate

Animal studies suggest improved tendon injury outcomes when applied locally.

Bone Regeneration moderate

Research indicates potential for bone healing via osteoblast regulation.

Dosing Protocols

Intramuscular injection directly into target muscle immediately post-workout for localized effects due to short half-life.

Goal	Dose	Frequency	Route
Standard Protocol	100-300mcg	Daily, post-workout	IM into target muscle
Progressive Titration	100mcg → 300mcg	Daily, increasing weekly	IM bilateral
Localized Recovery	200-300mcg	Immediately post-workout	IM into worked muscle groups

Reconstitution Instructions

Materials Needed:

MGF lyophilized powder (typically 5mg vial)
Bacteriostatic water (3.0mL recommended)
Insulin syringes (29-31 gauge)
Alcohol swabs

1 Allow vial to reach room temperature
2 Clean rubber stopper with alcohol swab
3 Add 3.0mL bacteriostatic water for ~1.67mg/mL concentration
4 Inject slowly along vial wall, not directly onto powder
5 Gently swirl to dissolve; never shake
6 Store refrigerated at 2-8°C
7 Use within 30 days of reconstitution

Interactions

PEG-MGF

Same active peptide with different half-lives. Combining is redundant; choose one based on protocol preference.

monitor

IGF-1 LR3

Both target IGF-1 pathways; combining risks receptor overstimulation.

monitor

BPC-157

Complementary mechanisms. BPC-157 promotes angiogenesis; MGF activates satellite cells.

synergistic

TB-500

TB-500 reduces inflammation and promotes cell migration; MGF activates muscle stem cells.

synergistic

What to Expect

Immediate

Very short half-life means localized effects at injection site within minutes

Week 1-2

Reduced muscle soreness in targeted areas; subtle recovery improvements

Week 4-8

Improved recovery in targeted muscles; enhanced training capacity

Side Effects & Safety

Common Side Effects

Injection site soreness
Mild fatigue

Stop Signs – Discontinue if:

Any unusual growths, lumps, or rapid tissue changes
Severe injection site reactions
Persistent headaches or vision changes
Signs of hypoglycemia

Contraindications

Any history of cancer or neoplastic disease
Pregnancy or breastfeeding
Uncontrolled diabetes

Quality Checklist

Good Signs

White or off-white fluffy cake appearance
Crystal clear solution after reconstitution
Certificate of Analysis with HPLC purity >98%

Warning Signs

Minor clumping that dissolves with gentle swirling

Bad Signs

Collapsed or discolored powder
Persistent cloudiness or visible particles

Frequently Asked Questions

Why is MGF injected directly into muscles post-workout?

MGF has a 5-7 minute half-life and activates satellite stem cells locally at the injection site. Post-workout timing is critical because muscles are primed for growth and recovery. Direct intramuscular injection confines effects to the trained muscle group you want to develop.

How is MGF different from PEG-MGF?

Standard MGF has a 5-7 minute half-life requiring daily injections. PEG-MGF (pegylated) lasts much longer (hours). Choose based on protocol preference: frequent localized doses (MGF) or fewer higher-dose injections (PEG-MGF). Effects are similar; administration differs.

Can MGF cause hypoglycemia?

Possibly, though less likely than IGF-1 LR3 due to MGF’s very short half-life and localized action. However, the post-workout window and direct muscle injection make hypoglycemia unlikely. Still monitor early use and consume carbs post-injection as a precaution.

How long do I need to use MGF to see muscle growth?

Week 1-2 shows reduced soreness in targeted muscles. Week 4-8 shows noticeable improvements in trained muscle size and recovery capacity. Most users run 8-12 week cycles with equal off-time. Structural gains from satellite cell activation may persist after discontinuation.

References

MGF-E Peptide Human Muscle Cell Study

(2011)

MGF significantly increased satellite cell proliferation at 3ng/ml with age-dependent effects.
Mechano-Growth Factor Minireview

(2010)

Overview of MGF as IGF-I gene product involved in tissue repair, upregulated following exercise and injury.

Disclaimer

This information is for educational and research purposes only. Consult a healthcare professional before use.

PEPS MN / KNOWLEDGE LIBRARY

MK-677 (Ibutamoren)

Ghrelin Receptor Agonist | Oral Growth Hormone Secretagogue

Weight: 624.77 Da

Half-life: ~24 hours

7 studies

2008 latest

3 recent

Well Studied

Community Research

Join others researching MK-677 — share findings, ask questions, and learn from real experiences

View Results Aggregated community findings

Discussion Questions & experiences

Submit Your Findings Contribute your research data

Oral compound activating ghrelin receptors to trigger growth hormone release while preserving natural production. Achieves superior oral bioavailability exceeding 60% with a 24-hour half-life, making it unique among GH secretagogues for its convenient once-daily oral dosing.

Mechanism of Action

Selectively binds GHS-R1a receptors in hypothalamus and pituitary, triggering pulsatile growth hormone release while maintaining natural circadian patterns.

01 97% increase in 24-hour growth hormone secretion

02 40-72% elevation in IGF-1 levels

03 Enhanced sleep quality with improved REM patterns

04 Preferential lean tissue gains of 1.1-2.7kg over 8-12 months

05 15% basal metabolic rate increase within 2 weeks

06 Oral administration (no injections required)

Molecular Data

Molecular Weight

624.77 Da

Type

Non-peptide ghrelin receptor agonist

Research Indications

Growth Hormone

GH Restoration most effective

Restores youthful growth hormone levels in elderly subjects with 97% increase in 24-hour secretion.

IGF-1 Enhancement most effective

Sustained 40-72% IGF-1 elevation over extended periods.

Sleep Enhancement effective

20% REM increase in younger adults; 50% improvement in elderly.

Body Composition

Muscle Preservation most effective

Demonstrates +2.69g/day nitrogen retention versus -8.97g/day placebo, protecting lean mass during caloric restriction.

Fat-Free Mass effective

Increases fat-free mass with preferential lean tissue accrual.

Metabolic Rate effective

15% basal metabolic rate elevation documented at 2 weeks.

Bone Health

Bone Formation effective

39-45% increase in bone formation markers within 6-8 weeks.

Dosing Protocols

Optimal bioavailability eliminates injection requirements with convenient daily dosing. Take at bedtime on empty stomach for best results.

Goal	Dose	Frequency	Route
Body composition/anti-aging	25mg	1x daily	Oral (bedtime, empty stomach)
Sleep quality improvement	25mg	1x nightly	Oral (30 minutes before bed)
Conservative initiation	12.5mg	1x daily	Oral (assess tolerance)

Interactions

CJC-1295

Complementary GH pathways providing combined pulsatile and baseline elevation.

synergistic

Ipamorelin

Both stimulate GH release through different mechanisms.

synergistic

GHRP-2

MK-677 baseline elevation combines with GHRP-2 pulsatile spikes.

synergistic

TB-500

Non-competing mechanisms enhancing recovery effects.

compatible

BPC-157

Systemic growth factors complement localized healing.

compatible

HGH

Redundant effects without proportional benefits.

avoid

Insulin

MK-677 decreases insulin sensitivity; requires blood glucose monitoring.

monitor

LGD-4033

Case report documents 85.7% testosterone suppression and significant liver enzyme elevation when combined.

monitor

What to Expect

Week 1-2

Improved sleep quality, vivid dreams, possible appetite increase

Week 2-4

Enhanced recovery, better sleep architecture, initial body composition changes

Week 4-8

Noticeable lean mass gains, continued sleep benefits

Week 8-12

Maximum body composition improvements, sustained GH elevation

Side Effects & Safety

Common Side Effects

Appetite stimulation (>50% of users)
Water retention (30-40%)
Lethargy (20-30%)
Fasting glucose elevation (5-15mg/dL)
Note on testosterone suppression: at doses up to 20 mg daily, MK-677 is unlikely to cause significant testosterone suppression on its own. Above 20 mg daily, the likelihood of suppression and other side effects (insulin resistance, water retention, lethargy) increases. The case report documenting 85.7% testosterone suppression involved co-administration with LGD-4033, a SARM known to be profoundly suppressive, making the SARM the likely primary driver of that suppression.

Stop Signs – Discontinue if:

Shortness of breath, chest pain, or unusual fatigue
Blood glucose levels >100mg/dL or diabetes symptoms
Liver enzyme elevation (ALT/AST >2x upper normal)
Severe fluid retention or unexplained swelling
Any concerning cardiovascular symptoms

Contraindications

Heart disease or congestive heart failure
Diabetes or pre-diabetes
Active cancer
Severe cardiovascular disease
Pregnancy or breastfeeding

Quality Checklist

Good Signs

Pharmaceutical-grade capsules with professional labeling
Batch numbers and expiration dates
Third-party testing documentation
Certificate of analysis showing >98% purity

Warning Signs

Products labeled ‘for research only’ may lack quality control

Bad Signs

Dietary supplement claims (FDA prohibits MK-677 in supplements)
Unknown purity or source without certificates of analysis
Unusually low prices suggesting counterfeit product

Frequently Asked Questions

Why is MK-677 oral when most peptides are injected?

MK-677 is not actually a peptide—it’s a small-molecule non-peptide ghrelin receptor agonist with excellent oral bioavailability (>60%) and a 24-hour half-life. This allows convenient once-daily oral dosing without injections, making it uniquely practical among GH secretagogues.

Does MK-677 increase testosterone suppression when combined with SARMs?

At doses up to 20mg daily, MK-677 alone causes minimal testosterone suppression. However, one case report documented 85.7% testosterone suppression when combined with LGD-4033 (a SARM). The SARM was likely the primary driver of suppression, not MK-677.

How much does MK-677 increase appetite?

Appetite stimulation affects >50% of users at 25mg doses. This is direct ghrelin mimicry—the same mechanism that increases GH. If appetite stimulation is problematic, reduce dose to 12.5mg or use ipamorelin instead for cleaner GH elevation without hunger.

Does MK-677 cause water retention?

Yes. 30-40% of users experience water retention from MK-677’s GH stimulation and sodium retention effects. This appears within the first 2-4 weeks. Sodium management and adequate hydration help minimize bloating, and effects often diminish over time as the body adapts.

References

Effects of a 7-day treatment with a novel, orally active, growth hormone (GH) secretagogue, MK-677, on 24-hour GH profiles, insulin-like growth factor I, and adrenocortical function in normal young men

Copinschi, G., et al.

Journal of Clinical Endocrinology & Metabolism (1996)

Randomized, double-blind crossover in 9 healthy young men. 7-day oral MK-677 (5 and 25mg) increased 24-hour GH profiles dose-dependently while preserving circadian patterns.
Stimulation of the growth hormone (GH)-insulin-like growth factor I axis by daily oral administration of a GH secretagogue (MK-677) in healthy elderly subjects

Chapman, I.M., et al.

Journal of Clinical Endocrinology & Metabolism (1996)

Randomized, double-blind trial in 32 elderly subjects (64-81 years). 25mg/day MK-677 for up to 4 weeks increased mean 24-hour GH by 97% and restored IGF-I concentrations to young adult levels.
Prolonged oral treatment with MK-677, a novel growth hormone secretagogue, improves sleep quality in man

Copinschi, G., et al.

Neuroendocrinology (1997)

In young adults, 25mg MK-677 increased stage IV sleep duration by 50% and REM sleep by 20%. In older adults, REM sleep increased nearly 50% with decreased REM latency. Sleep deviations dropped from 42% to 8%.
MK-677, an orally active growth hormone secretagogue, reverses diet-induced catabolism

Murphy, M.G., et al.

Journal of Clinical Endocrinology & Metabolism (1998)

Double-blind crossover in 8 healthy volunteers under caloric restriction. 25mg/day MK-677 for 7 days reversed nitrogen wasting (+2.69g/day vs -8.97g/day placebo) and significantly increased IGF-I.
Two-month treatment of obese subjects with the oral growth hormone (GH) secretagogue MK-677 increases GH secretion, fat-free mass, and energy expenditure

Chapman, I.M., et al.

Journal of Clinical Endocrinology & Metabolism (1998)

24 obese males treated with 25mg/day for 8 weeks showed sustained increases in GH, IGF-I, fat-free mass, and a transient increase in basal metabolic rate at 2 weeks.
Oral administration of the growth hormone secretagogue MK-677 increases markers of bone turnover in healthy and functionally impaired elderly adults

Murphy, M.G., et al.

Journal of Bone and Mineral Research (1999)

187 elderly adults (65+) across three placebo-controlled studies. 9 weeks of MK-677 increased serum osteocalcin by 29.4%, bone-specific alkaline phosphatase by 10.4%, and urinary NTX by 22.6%.
Effects of an oral ghrelin mimetic on body composition and clinical outcomes in healthy older adults: a randomized trial

Nass, R., et al.

Annals of Internal Medicine (2008)

12-month RCT in 65 healthy adults (60-81 years). MK-677 increased GH and IGF-I to young adult levels, increased fat-free mass while placebo group declined, and was generally well tolerated.

Disclaimer

This information is for educational and research purposes only. Consult a healthcare professional before use.

PEPS MN / KNOWLEDGE LIBRARY

PEG-MGF (Pegylated MGF)

Pegylated Mechano Growth Factor | IGF-1 Splice Variant

Weight: ~2,888 Da

Half-life: 48-72 hours (via PEGylation)

Chain: 24 amino acids

3 studies

2018 latest

limited

Community Research

Join others researching PEG-MGF — share findings, ask questions, and learn from real experiences

View Results Aggregated community findings

Discussion Questions & experiences

Submit Your Findings Contribute your research data

Modified IGF-1 variant with PEG attachment extending half-life from minutes to hours. Activates muscle satellite cells following mechanical stress or injury.

Mechanism of Action

Activates muscle satellite stem cells via receptor binding, stimulating MAPK/ERK signaling. Enhances protein synthesis and promotes muscle fiber repair. E-peptide domain exhibits distinct activity from mature IGF-1.

01 Extended half-life through PEGylation

02 Satellite cell activation for muscle repair

03 Recovery support following mechanical stress

04 Potential neuroprotection against oxidative stress

Molecular Data

Molecular Weight

~2,888 Da

Chain Length

24 amino acids

Type

IGF-1Ec splice variant C-terminal peptide

Amino Acid Sequence

YQPPSTNKNTKSQRRKGSTFEEHK

Complex or non-standard sequence format

Research Indications

Muscle Repair

Satellite Cell Activation most effective

Primary mechanism activating dormant muscle satellite cells which fuse to damaged fibers.

Delayed Senescence effective

Increases proliferative lifespan in younger muscle progenitor cells.

Enhanced Fusion Potential effective

Increases activated satellite cell fusion capacity supporting repair and hypertrophy.

Tissue Regeneration

Tendon Healing effective

Animal studies suggest improved Achilles tendon injury outcomes.

Bone Regeneration moderate

Rabbit models demonstrated faster healing via osteoblast regulation.

Cartilage Repair moderate

Research indicates potential for articular cartilage injury models.

Recovery

Exercise Recovery moderate

Naturally upregulated after mechanical stress; supplementation may enhance processes.

Injury Recovery effective

Localized injection near injury sites supports targeted tissue repair.

Dosing Protocols

Subcutaneous or intramuscular administration; post-workout timing aligns with natural MGF upregulation.

Goal	Dose	Frequency	Route
General Recovery	200mcg	2-3x weekly	SubQ or IM
Targeted Muscle Recovery	200-400mcg	Post-workout, 2-3x weekly	IM bilateral near target muscle
Injury Recovery	200-400mcg	2-3x weekly	IM near injury site
Conservative Protocol	100-200mcg	2x weekly	SubQ

Reconstitution Instructions

Materials Needed:

PEG-MGF lyophilized powder (typically 2mg vial)
Bacteriostatic water
Insulin syringes (29-31 gauge)
Alcohol swabs

1 Allow vial to reach room temperature
2 Clean rubber stopper with alcohol swab
3 Draw appropriate bacteriostatic water amount
4 Inject slowly along vial wall, not directly onto powder
5 Gently swirl to dissolve; never shake
6 Allow 2-5 minutes for full dissolution
7 Store refrigerated at 2-8°C
8 Protect from light

Interactions

IGF-1 LR3

Both target IGF-1 pathways; combining risks receptor overstimulation. Reduce doses significantly if combined.

monitor

Human Growth Hormone

HGH increases endogenous IGF-1/MGF. Combined use amplifies effects but monitor for excessive water retention and joint pain.

monitor

BPC-157

Complementary mechanisms. BPC-157 promotes angiogenesis; PEG-MGF activates satellite cells. Popular recovery stack.

synergistic

TB-500

TB-500 reduces inflammation and promotes cell migration; PEG-MGF activates muscle stem cells.

synergistic

Insulin

Both affect glucose metabolism. Monitor blood sugar carefully if combined.

monitor

Thymosin Beta-4

Different regenerative pathways may enhance tissue repair through multiple mechanisms.

synergistic

What to Expect

Week 1-2

Reduced muscle soreness post-workout; subtle recovery improvements

Week 2-4

Enhanced recovery between training; potential injury-related discomfort reduction

Week 4-8

Optimal muscle repair effects; improved training capacity from better recovery

Post-cycle

Benefits persist several weeks as tissue repair continues

Side Effects & Safety

Common Side Effects

Injection site soreness
Mild fatigue

Stop Signs – Discontinue if:

Any unusual growths, lumps, or rapid tissue changes
Severe injection site reactions beyond normal soreness
Persistent headaches or vision changes
Signs of hypoglycemia
Unexpected swelling or edema

Contraindications

Any history of cancer or neoplastic disease
Pregnancy or breastfeeding
Uncontrolled diabetes or severe hyperglycemia

Quality Checklist

Good Signs

White or off-white fluffy cake appearance indicates proper freeze-drying
Crystal clear solution after reconstitution with no particles
Certificate of Analysis with HPLC purity testing (>98%)

Warning Signs

Minor clumping that dissolves with gentle swirling is normal

Bad Signs

Collapsed or discolored powder suggests heat degradation
Persistent cloudiness or visible particles indicate contamination

Frequently Asked Questions

What makes PEG-MGF better than regular MGF for muscle recovery?

PEGylation extends the half-life from minutes to 48-72 hours, meaning you don’t need to inject as frequently and the peptide stays active longer in your system. Regular MGF has a very short half-life, limiting recovery window. PEG-MGF’s extended duration allows for deeper satellite cell activation and sustained muscle repair.

Should I inject PEG-MGF into the muscle I just trained?

Yes, localized injection near or into the damaged muscle is optimal. The file specifically lists ‘IM bilateral near target muscle’ for targeted recovery. Post-workout timing (within 1-2 hours) aligns with when your body naturally upregulates MGF, making that the ideal window for injection.

Can I stack PEG-MGF with testosterone for better muscle growth?

There’s no direct contraindication, but be cautious. PEG-MGF activates satellite cells (muscle stem cells) while testosterone increases protein synthesis and hormonal signals. The combination might work synergistically, but monitor for excessive water retention and joint pain, which can occur with combined growth-promoting agents.

Does PEG-MGF work for non-athletes wanting muscle maintenance?

Possibly, but PEG-MGF is most effective when there’s mechanical stress or injury to trigger satellite cell activation. Without training stimulus or injury, it won’t dramatically build muscle. It’s better for accelerating recovery after workouts or helping with injury rehabilitation rather than standalone muscle building.

References

MGF-E Peptide Human Muscle Cell Study

(2011)

Landmark study demonstrating MGF significantly increased satellite cell proliferation at 3ng/ml (P<0.001) with age-dependent effects.
MGF Inflammatory Response Study

(2018)

MGF overexpression modulated inflammatory cytokines and enhanced macrophage resolution during skeletal muscle injury recovery.
Mechano-Growth Factor Minireview

(2010)

Overview of MGF as IGF-I gene product involved in tissue repair, highlighting upregulation following exercise and injury.

Disclaimer

This information is for educational and research purposes only. Consult a healthcare professional before use.

PEPS MN / KNOWLEDGE LIBRARY

Sermorelin (Sermorelin acetate)

GHRH Analog | Growth Hormone Releasing Hormone

Weight: 3,358 Da

Half-life: 10-12 minutes

Chain: 29 amino acids

5 studies

2006 latest

1 recent

Well Studied

Community Research

Join others researching Sermorelin — share findings, ask questions, and learn from real experiences

View Results Aggregated community findings

Discussion Questions & experiences

Submit Your Findings Contribute your research data

Sermorelin is a synthetic 29-amino acid analog of human growth hormone-releasing hormone that stimulates natural growth hormone production while preserving physiological pulsatile patterns. Originally FDA-approved in 1997 for pediatric GH deficiency, it was discontinued in 2008 for manufacturing reasons, not safety concerns.

Mechanism of Action

Subcutaneous injection provides optimal bioavailability for binding GHRH receptors, stimulating pulsatile GH release while maintaining hypothalamic-pituitary axis integrity and allowing natural somatostatin negative feedback.

01 FDA-proven efficacy

02 Maintains natural GH pulsatile patterns

03 Preserves pituitary function

04 1.26kg lean mass increase documented in elderly

05 IGF-1 mediated anabolic effects

06 Allows natural feedback regulation

Molecular Data

Molecular Weight

3,358 Da

Chain Length

29 amino acids

Type

GHRH analog

Research Indications

Muscle Growth

Lean Body Mass Enhancement most effective

1.26kg lean mass increase documented in elderly men with improved muscle strength tests.

IGF-1 Mediated Growth effective

Endogenous IGF-1 stimulation drives protein synthesis and muscle growth.

Athletic Recovery effective

Enhanced recovery through physiological GH stimulation.

Anti-Aging

Age-Related GH Decline Reversal effective

Doubles 12-hour GH release in elderly subjects over 6 weeks.

Body Composition Improvement effective

Decreased adiposity and improved lean mass distribution.

Skin Quality Enhancement moderate

Improved skin thickness and quality.

Hormonal

Endogenous GH Stimulation moderate

Preserves natural axis function without suppression.

Natural Pulsatile Secretion moderate

Maintains physiological GH release patterns.

Dosing Protocols

Subcutaneous injection is the primary method. Bedtime administration aligns with natural nocturnal GH pulses. Avoid food 2+ hours before injection as carbohydrates blunt GH response.

Goal	Dose	Frequency	Route
Anti-aging/Longevity	200-300mcg	Once at bedtime	SubQ
Athletic Performance	300-500mcg	Once at bedtime	SubQ
Body Composition	200mcg	5 days weekly	SubQ
Combination Therapy	200mcg + GHRP	Once daily	SubQ co-injection

Reconstitution Instructions

Materials Needed:

Sermorelin acetate lyophilized powder (2-5mg vial)
Bacteriostatic water for injection (3mL)
Insulin syringes (28-30 gauge)
Alcohol swabs

1 Allow vial to reach room temperature
2 Clean vial top with alcohol swab; allow to dry
3 Inject 3mL bacteriostatic water slowly against vial wall (not directly on powder)
4 Gently swirl in circular motion – do not shake vigorously
5 Allow 2-3 minutes until powder dissolves into clear solution
6 Store reconstituted solution at 2-8°C; use within 10-30 days
7 Inject subcutaneously at 45-degree angle; rotate sites

Intranasal spray is available with 69% patient preference over injection. Lower bioavailability but bypasses first-pass metabolism.

Goal	Dose	Frequency	Route
Nasal administration	30+ mcg/kg	Once daily at bedtime	Nasal spray

Interactions

Ipamorelin

Excellent combination producing 3-5 fold increases in GH release.

synergistic

CJC-1295

Highly effective combination – CJC-1295 provides sustained 6-8 day release while sermorelin offers immediate pulsatile effects.

synergistic

GHRP-2

Combined GHRH+GHRP-2 produces 54-fold GH increases compared to 20-fold with GHRH alone.

synergistic

Octreotide/Lanreotide

Somatostatin analogs directly block GH release by activating inhibitory receptors.

avoid

Prednisone

High-dose glucocorticoids suppress pituitary GH release and reduce GHRH receptor sensitivity.

monitor

Insulin

GH antagonizes insulin action; monitor combination closely.

monitor

Thyroid Hormones

Essential combination as untreated hypothyroidism prevents sermorelin response.

compatible

What to Expect

Week 1-2

IGF-1 elevation begins; improved sleep quality and recovery

Week 2-4

Body composition changes begin; increased energy and well-being

Week 4-8

Visible muscle tone improvements; fat reduction; skin quality enhancement

Week 8-12

Sustained improvements; optimal IGF-1 elevation

Month 3-6

Maximum benefits: muscle growth, fat loss, anti-aging effects

Side Effects & Safety

Common Side Effects

Injection site reactions (16.7% of patients – generally mild)
Nasal irritation (intranasal route)

Stop Signs – Discontinue if:

Signs of pituitary tumor growth (headaches, vision changes)
Severe injection site reactions or generalized allergic responses
Uncontrolled diabetes or significant glucose intolerance
New onset or worsening malignancy symptoms

Contraindications

Active malignancy
Pituitary tumors
Pregnancy

Quality Checklist

Good Signs

Completely clear and colorless solution without particles, cloudiness, or precipitation
Greater than 98% peptide purity per USP standards
Sterile, nonpyrogenic lyophilized powder
Maintained at 2-8°C throughout transport
Produced in FDA-registered facilities following cGMP

Warning Signs

Brief room temperature exposure acceptable up to 72 hours but should be refrigerated promptly

Bad Signs

Any cloudiness, particles, color changes, or precipitation indicates degradation
Molecular weight should be exactly 3,358 daltons (free base) or 3,418 daltons (acetate salt)

Frequently Asked Questions

Why was sermorelin discontinued if it was FDA-approved and safe?

Sermorelin was discontinued in 2008 for manufacturing reasons, not safety concerns. It was approved in 1997 and had a solid safety record, but the manufacturer stopped production. This left a gap in the market—sermorelin is now available through research/compounded sources but not as a branded pharmaceutical.

How does sermorelin preserve natural GH patterns better than taking GH directly?

Sermorelin stimulates your pituitary to release GH in its natural pulsatile pattern (high at night, low during day). Direct GH injection creates constant levels, suppressing your natural axis. Sermorelin preserves the hypothalamic-pituitary-axis (HPA) feedback loop, meaning you maintain natural regulation rather than becoming dependent on external hormones.

Why shouldn’t I eat food 2+ hours before sermorelin injection?

Carbohydrates and high blood sugar suppress GH release. Eating before injection blunts your GH response by 50-80%, making the injection ineffective. Bedtime administration on an empty stomach ensures maximum GH secretion from the natural nocturnal pulse your body is primed to produce.

Can I combine sermorelin with GHRP-2 for even bigger GH increases?

Yes, and it’s highly effective. GHRH + GHRP-2 combination produces 54-fold GH increases vs 20-fold with GHRH alone. However, start cautiously and monitor for joint pain/water retention. The synergy is excellent for body composition but requires more careful dose management than either alone.

References

The effects of intranasal insufflation of growth hormone releasing factor analogue GRF 1-29 NH2 on growth hormone secretion in children with short stature

Laron, Z., et al.

Clinical Endocrinology (1988)

Intranasal GRF 1-29 at 100mcg/kg induced prompt GH release in prepubertal children with peak values at 15 minutes. Demonstrated feasibility of nasal delivery with minimal side effects.
Growth hormone (GH)-releasing hormone-(1-29) twice daily reverses the decreased GH and insulin-like growth factor-I levels in old men

Corpas, E., et al.

Journal of Clinical Endocrinology & Metabolism (1992)

Landmark study in healthy old men (68 +/- 6.2 yr). High-dose GHRH(1-29) twice daily for 14 days reversed age-related decreases in GH and IGF-I to levels not significantly different from young men.
Once daily subcutaneous growth hormone-releasing hormone therapy accelerates growth in growth hormone-deficient children during the first year of therapy

Geref International Study Group

Journal of Clinical Endocrinology & Metabolism (1996)

Pivotal multicenter trial with 110 prepubertal GH-deficient children. Sermorelin 30mcg/kg/day at bedtime increased height velocity from 4.1 to 8.0 cm/year at 6 months, with 74% achieving good response.
Endocrine and metabolic effects of long-term administration of [Nle27]growth hormone-releasing hormone-(1-29)-NH2 in age-advanced men and women

Vittone, J., et al.

Journal of Clinical Endocrinology & Metabolism (1997)

5-month single-blind RCT in 19 adults (55-71 yr). Nightly GHRH analog for 4 months activated somatotropic axis. Men showed increased lean body mass, insulin sensitivity, and well-being. Skin thickness improved in both genders.
Sermorelin: a better approach to management of adult-onset growth hormone insufficiency?

Walker, R.F.

Clinical Interventions in Aging (2006)

Review arguing sermorelin preserves pituitary function and physiological GH pulsatility, offering a safer alternative to exogenous GH for adult-onset GH insufficiency.

Disclaimer

This information is for educational and research purposes only. Consult a healthcare professional before use.

PEPS MN / KNOWLEDGE LIBRARY

Tesa/IPA Protocol (Tesa-IPA)

Tesamorelin + Ipamorelin GH Secretagogue Blend

4 studies

2024 latest

3 recent

Limited Research

Community Research

Join others researching Tesa/IPA Protocol — share findings, ask questions, and learn from real experiences

View Results Aggregated community findings

Discussion Questions & experiences

Submit Your Findings Contribute your research data

The Tesa/IPA blend combines two complementary growth hormone secretagogues: Tesamorelin (a GHRH analog that stimulates GH release from the pituitary) and Ipamorelin (a selective ghrelin mimetic/GHRP that amplifies GH pulses). This combination addresses both the GHRH and GHRP pathways for synergistic GH release. Common formulations include 5mg/5mg (1:1 ratio) and 10mg/3mg (higher Tesamorelin) variants. Tesamorelin is FDA-approved for HIV-associated lipodystrophy, while Ipamorelin remains investigational.

Mechanism of Action

The blend leverages two distinct GH-releasing pathways: Tesamorelin is a synthetic GHRH analog that directly stimulates growth hormone-releasing hormone receptors on pituitary somatotrophs, triggering GH synthesis and secretion in a pulsatile, physiological manner. Ipamorelin is a selective ghrelin receptor (GHS-R1a) agonist that amplifies GH pulses without significantly affecting cortisol or prolactin. Together, they produce synergistic GH release greater than either compound alone, while maintaining the body’s natural feedback mechanisms.

01 Synergistic GH release from dual pathways

02 More physiological pulsatile GH secretion

03 Tesamorelin’s proven lipodystrophy benefits

04 Ipamorelin’s clean side effect profile

05 Does not significantly affect cortisol or prolactin

06 Single injection convenience

07 May improve body composition, sleep, and recovery

Molecular Data

Type

Dual GH secretagogue combination

Amino Acid Sequence

Tesamorelin (GHRH analog) + Ipamorelin (GHRP)

Complex or non-standard sequence format

Research Indications

Body Composition

Fat Reduction effective

Tesamorelin has demonstrated fat reduction in clinical trials; synergy with Ipamorelin may enhance effects.

Visceral Fat Loss most effective

Tesamorelin specifically reduces visceral adipose tissue (FDA-approved indication).

Lean Mass Support moderate

Enhanced GH promotes protein synthesis and lean tissue preservation.

Recovery & Wellness

Sleep Quality effective

GH secretagogues often improve deep sleep quality.

Recovery Enhancement moderate

Enhanced GH supports tissue repair and recovery from exercise.

Anti-Aging Support moderate

Restoring more youthful GH levels may provide anti-aging benefits.

Metabolic Health

Lipid Profile moderate

Tesamorelin has shown improvements in lipid parameters in studies.

IGF-1 Optimization effective

Increased GH leads to increased IGF-1 production.

Dosing Protocols

Subcutaneous injection, typically administered before bed or in the morning on an empty stomach. Evening dosing may enhance natural nighttime GH pulse. Avoid eating 2-3 hours before and 30-60 minutes after injection for optimal results.

Goal	Dose	Frequency	Route
Standard protocol (5/5 blend)	200-400mcg total	Once daily (evening)	SubQ
Enhanced protocol (10/3 blend)	300-500mcg total	Once daily (evening)	SubQ
Twice daily (advanced)	200-300mcg per dose	Morning and evening	SubQ

Reconstitution Instructions

Materials Needed:

Tesa/IPA vial (5/5mg or 10/3mg)
Bacteriostatic water (2-3mL)
Insulin syringes
Alcohol prep pads

1 Clean vial top with alcohol pad
2 Add 2mL bacteriostatic water for convenient dosing
3 Gently swirl – do not shake
4 Solution should appear clear
5 Label with date and concentration
6 Store refrigerated immediately
7 Use within 4-6 weeks

Interactions

Tesamorelin (standalone)

Already contains Tesamorelin – do not add more.

avoid

Ipamorelin (standalone)

Already contains Ipamorelin – do not add more.

avoid

CJC-1295

Both Tesamorelin and CJC-1295 are GHRH analogs; combining may cause excessive stimulation.

monitor

GHRP-6/GHRP-2

Already has GHRP pathway covered by Ipamorelin; adding more GHRPs may be excessive.

monitor

MK-677

Both affect GH release; combination may be excessive and affect glucose.

monitor

BPC-157

Different mechanisms; can complement for healing with GH support.

compatible

Semaglutide

Different pathways; some combine for body composition goals.

compatible

Insulin

GH affects glucose metabolism; diabetics should monitor carefully.

monitor

What to Expect

Week 1-2

Improved sleep quality often noticed first; initial GH response

Week 2-4

Enhanced recovery; subtle body composition changes beginning

Week 4-8

Noticeable fat loss (especially visceral); improved energy

Week 8-16

Full body composition benefits; continued improvements

Side Effects & Safety

Common Side Effects

Injection site reactions (redness, itching)
Water retention (usually transient)
Tingling or numbness in extremities
Joint stiffness
Increased hunger (Ipamorelin effect)

Stop Signs – Discontinue if:

Severe injection site reactions
Significant swelling or edema
Signs of glucose dysregulation
Severe joint pain
Allergic reactions

Contraindications

Active malignancy (GH may promote tumor growth)
Diabetic retinopathy
Pregnancy or breastfeeding
Pituitary disorders
Hypersensitivity to components

Quality Checklist

Good Signs

Third-party testing confirming both components
Certificate of Analysis with ratios verified
Reputable research supplier
Proper cold chain shipping

Warning Signs

Tesamorelin is FDA-approved as Egrifta – research blends are not
Ipamorelin remains investigational

Bad Signs

No Certificate of Analysis
Cannot verify Tesamorelin:Ipamorelin ratio
Discolored or particulate solution

Frequently Asked Questions

Why combine tesamorelin and ipamorelin instead of using them separately?

Tesamorelin and ipamorelin work on complementary GH-release pathways (GHRH vs GHRP receptors), producing synergistic GH release greater than either alone. The combination mimics natural pulsatile GH secretion more effectively while maintaining safety with less cortisol/prolactin elevation than GHRPs used solo.

What’s the ideal 5/5 vs 10/3 ratio for Tesa/IPA and when to use each?

5/5 (equal parts) provides balanced GH stimulation suitable for general recovery. The 10/3 (higher tesamorelin) variant emphasizes visceral fat loss and metabolic effects. Choose 5/5 for athletic recovery; 10/3 for fat-loss focused protocols with body composition optimization goals.

Should the Tesa/IPA blend be taken on an empty stomach?

Yes, both tesamorelin and ipamorelin work best on an empty stomach (2-3 hours before eating). Evening injection (before bed) on an empty stomach optimizes the protocol by aligning with natural nighttime GH pulses and avoiding food-induced metabolic interference.

Can Tesa/IPA be combined with CJC-1295 or other GH secretagogues?

No, combining Tesa/IPA (which already contains both GHRH and GHRP pathways) with additional GHRPs or GHRH analogs risks excessive pituitary stimulation. The blend is specifically designed as a complete dual-pathway system that shouldn’t require additional GH secretagogues.

References

Metabolic effects of a growth hormone-releasing factor in patients with HIV

Falutz J, Allas S, Blot K, et al.

New England Journal of Medicine (2007)

Landmark RCT in 412 HIV patients: tesamorelin 2 mg daily for 26 weeks reduced visceral fat by 10.9% vs 0.6% placebo, improved lipid profiles with no change in subcutaneous fat.
Ipamorelin, the first selective growth hormone secretagogue

Raun K, Hansen BS, Johansen NL, et al.

European Journal of Endocrinology (1998)

Ipamorelin is the first GHRP-receptor agonist with selectivity for GH release similar to GHRH; does not release ACTH or cortisol even at doses over 200-fold the ED50 for GH.
GHRH + GHRP Synergy

Endocrine Reviews

Combining GHRH and GHRP pathways produces synergistic GH release greater than either agent alone, driven by independent receptor mechanisms on pituitary somatotrophs.
No Published Studies on Tesa/IPA Combination

N/A (2024)

No clinical trials have evaluated the specific tesamorelin + ipamorelin blend; synergy is inferred from GHRH/GHRP pharmacology and individual component data.

Disclaimer

This information is for educational and research purposes only. Consult a healthcare professional before use.

PEPS MN / KNOWLEDGE LIBRARY

Tesamorelin (Egrifta SV)

FDA Approved

GHRH Analog | Visceral Fat Reduction

Weight: 5,135.9 Da

Half-life: 26-38 minutes

Chain: 44 amino acids

5 studies

2025 latest

2 recent

FDA Approved

Community Research

Join others researching Tesamorelin — share findings, ask questions, and learn from real experiences

View Results Aggregated community findings

Discussion Questions & experiences

Submit Your Findings Contribute your research data

Tesamorelin is an FDA-approved synthetic GHRH analog designed for HIV-associated lipodystrophy treatment. It provides selective visceral fat targeting with 15-20% visceral fat reduction in clinical trials while preserving subcutaneous fat.

Mechanism of Action

Subcutaneous injection provides optimal bioavailability for GHRH receptor binding and pulsatile GH release stimulation, selectively targeting visceral adipose tissue while sparing subcutaneous fat.

01 FDA-approved formulation

02 Selective visceral fat targeting (15-20% reduction)

03 Proven clinical efficacy

04 Standardized dosing

05 37% liver fat reduction in NAFLD

06 Preserved subcutaneous fat

Molecular Data

Molecular Weight

5,135.9 Da

Chain Length

44 amino acids

Type

GHRH analog

Amino Acid Sequence

One-letter: HADGIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

H₂N

H 1

O ‖ C

A 2

O ‖ C

D 3

O ‖ C

G 4

O ‖ C

I 5

O ‖ C

F 6

O ‖ C

T 7

O ‖ C

N 8

O ‖ C

S 9

O ‖ C

Y 10

O ‖ C

R 11

O ‖ C

K 12

O ‖ C

V 13

O ‖ C

L 14

O ‖ C

G 15

O ‖ C

Q 16

O ‖ C

L 17

O ‖ C

S 18

O ‖ C

A 19

O ‖ C

R 20

O ‖ C

K 21

O ‖ C

L 22

O ‖ C

L 23

O ‖ C

Q 24

O ‖ C

D 25

O ‖ C

I 26

O ‖ C

M 27

O ‖ C

S 28

O ‖ C

R 29

O ‖ C

Q 30

O ‖ C

Q 31

O ‖ C

G 32

O ‖ C

E 33

O ‖ C

S 34

O ‖ C

N 35

O ‖ C

Q 36

O ‖ C

E 37

O ‖ C

R 38

O ‖ C

G 39

O ‖ C

A 40

O ‖ C

R 41

O ‖ C

A 42

O ‖ C

R 43

O ‖ C

L 44

COOH

His

Ala

Asp

Gly

Ile

Phe

Thr

Asn

Ser

Tyr

Arg

Lys

Val

Leu

Gly

Gln

Leu

Ser

Ala

Arg

Lys

Leu

Gln

Asp

Ile

Met

Ser

Arg

Gln

Gly

Glu

Ser

Asn

Gln

Glu

Arg

Gly

Ala

Arg

Ala

Arg

Leu

N-terminus C-terminus

Hydrophobic

Polar

Positive (+)

Negative (-)

Modified

Research Indications

Weight Loss

HIV-Associated Lipodystrophy most effective

FDA-approved indication showing 15-20% visceral fat reduction in clinical trials.

Selective Visceral Fat Targeting most effective

Unique mechanism that reduces dangerous visceral fat while sparing subcutaneous fat.

Sustained Fat Loss effective

Maintained weight loss with continuous treatment over 52+ weeks in clinical studies.

Metabolic

Triglyceride Reduction effective

12.3% reduction in triglyceride levels.

Cholesterol Profile Improvement effective

7.2% improvement in cholesterol markers.

NAFLD Treatment effective

37% liver fat reduction over 12 months.

Body Composition

Lean Mass Preservation moderate

Preserves lean muscle mass during fat loss.

IGF-1 Elevation moderate

26% increase in IGF-1 levels.

Dosing Protocols

Subcutaneous injection to abdomen (avoid navel ±2 inches). Evening injection preferred for GH circadian rhythm alignment.

Goal	Dose	Frequency	Route
HIV Lipodystrophy (FDA-approved)	1.4mg	Once daily	SubQ
Visceral Fat Reduction	2mg	Once daily	SubQ
Anti-aging/Body Composition	1-2mg	5-7x weekly	SubQ
NAFLD Treatment	2mg	Once daily (12 months)	SubQ
Cognitive Enhancement	1mg	Once daily (20 weeks)	SubQ

Reconstitution Instructions

Materials Needed:

Tesamorelin lyophilized powder
Sterile water (Egrifta SV) or Bacteriostatic water (Egrifta WR)
Insulin syringes
Alcohol prep pads

1 Allow vial to reach room temperature
2 Egrifta SV: Add 0.5mL sterile water to 2mg vial – use immediately
3 Egrifta WR: Add 1.3mL bacteriostatic water to 11.6mg vial – stable 7 days
4 Gently swirl (don’t shake vigorously)
5 Withdraw appropriate dose (~0.35mL for 1.4mg)
6 Inject SubQ, rotating sites
7 Store reconstituted WR at room temperature up to 7 days

Interactions

Ipamorelin

Synergistic GH stimulation; monitor IGF-1 levels.

monitor

CJC-1295

Combined use may elevate IGF-1 supraphysiologically.

monitor

Sermorelin

Similar mechanism; risk of excessive effects at higher doses.

monitor

Insulin

3.3-fold diabetes risk increase; monitor glucose closely.

monitor

Metformin

May mitigate glucose intolerance associated with tesamorelin.

compatible

Prednisone

Decreases corticosteroid effectiveness.

monitor

Octreotide

Blocks GH release, negates tesamorelin effects.

avoid

Growth Hormone

Redundant; risk of acromegaly-like effects.

avoid

What to Expect

Week 1-2

IGF-1 levels begin to rise, possible mild water retention or joint discomfort

Week 4-6

Early metabolic changes; improved energy/sleep

Week 8-12

Visible visceral fat reduction begins, waist circumference may decrease

Week 12-26

Peak effects achieved with significant body composition improvements

Side Effects & Safety

Common Side Effects

Injection site reactions (17%)
Joint pain (13%)
Water retention

Stop Signs – Discontinue if:

Development of diabetes or severe glucose intolerance (HbA1c ≥6.5%)
Signs of malignancy
Severe hypersensitivity reactions
Excessive IGF-1 elevation (>2 SD above normal) with acromegaly symptoms

Contraindications

Active malignancy
Pituitary disorders
Pregnancy

Quality Checklist

Good Signs

FDA-approved formulations (Egrifta SV/WR from licensed pharmacy)
White crystalline powder (uniform, cake-like)
Clear reconstituted solution (colorless, no particles)
Proper packaging (sealed vials, intact stoppers)

Warning Signs

Compounded formulations may have quality/potency variability

Bad Signs

Discolored or cloudy solution (yellow/brown indicates degradation)
Visible particles or precipitate

Frequently Asked Questions

Does tesamorelin specifically target visceral fat or does it reduce overall body fat?

Tesamorelin uniquely targets visceral (deep abdominal) fat while sparing subcutaneous fat. This selective mechanism makes it FDA-approved specifically for HIV-associated lipodystrophy – the visceral fat reduction of 15-20% occurs without proportional subcutaneous fat loss, improving metabolic health and reducing cardiovascular risk.

Can tesamorelin improve cognitive function or is that just a side benefit?

Cognitive improvement isn’t a primary effect, but a Phase 2 trial in 152 older adults (55-87 years) showed favorable effects on cognition, particularly executive function (P=0.005), with 117% IGF-1 increases. This suggests potential anti-aging brain benefits, though larger trials are needed for confirmation.

Does tesamorelin increase diabetes risk like other GH therapies?

Yes, tesamorelin carries a documented 3.3-fold increased diabetes risk compared to placebo. Close glucose monitoring is essential, especially in pre-diabetic patients. Metformin co-treatment may mitigate this risk, and diabetics require careful medication adjustment.

Why use tesamorelin over semaglutide for visceral fat loss?

Tesamorelin uniquely spares subcutaneous fat while targeting visceral fat, making it better for patients wanting to preserve healthy fat deposits. Semaglutide causes general weight loss across all fat depots. Choose tesamorelin for selective visceral fat reduction in metabolically healthy individuals; semaglutide for comprehensive weight loss.

References

Metabolic Effects of a Growth Hormone-Releasing Factor in Patients with HIV (LIPO-010)

Falutz, J., et al.

New England Journal of Medicine (2007)

Pivotal Phase III trial in 412 HIV patients. Tesamorelin 2mg daily for 26 weeks significantly decreased visceral fat and improved lipid profiles compared to placebo.
Effects of Tesamorelin in HIV-Infected Patients with Abdominal Fat Accumulation: Randomized Placebo-Controlled Trial with Safety Extension (CTR-1011)

Falutz, J., et al.

Journal of Acquired Immune Deficiency Syndromes (2010)

404 HIV patients treated for up to 12 months. 69% achieved ≥8% VAT reduction vs 33% placebo. VAT benefits were lost upon discontinuation, confirming need for continuous therapy.
Effects of Growth Hormone-Releasing Hormone on Cognitive Function in Adults with MCI and Healthy Older Adults

Baker, L.D., et al.

Archives of Neurology (2012)

152 adults (ages 55-87) treated with tesamorelin 1mg daily for 20 weeks. Favorable effect on cognition (P=0.03), with particular benefit on executive function (P=0.005) and IGF-1 increase of 117%.
Effects of Tesamorelin on Non-Alcoholic Fatty Liver Disease in HIV: A Randomised, Double-Blind, Multicentre Trial

Stanley, T.L., et al.

Lancet HIV (2019)

61 HIV patients with NAFLD randomized to tesamorelin 2mg vs placebo for 12 months. 37% relative reduction in hepatic fat fraction (P=0.02), with prevention of fibrosis progression on liver biopsy.
Body Composition, Hepatic Fat, Metabolic, and Safety Outcomes of Tesamorelin: A Meta-Analysis of Randomized Controlled Trials

Elgenidy, A., et al.

HIV Medicine (2025)

Meta-analysis of 5 RCTs showing significant VAT reduction (MD=-27.71 cm², P<0.001), increased lean body mass (MD=1.42 kg, P<0.001), and improved hepatic fat and IGF-1 levels without serious safety concerns.

Disclaimer

This information is for educational and research purposes only. Consult a healthcare professional before use.

PEPS MN / KNOWLEDGE LIBRARY

HGH (Somatropin)

FDA Approved

Human Growth Hormone | Somatropin

Weight: 22,124 Da

Half-life: 3-4 hours (SC), 20-30 minutes (IV)

Chain: 191 amino acids

4 studies

2022 latest

2 recent

FDA Approved

Community Research

Join others researching HGH — share findings, ask questions, and learn from real experiences

View Results Aggregated community findings

Discussion Questions & experiences

Submit Your Findings Contribute your research data

Human Growth Hormone (HGH/Somatropin) is a 191-amino acid polypeptide hormone FDA-approved for pediatric and adult growth hormone deficiency, HIV-associated wasting, and other conditions. It provides both direct and indirect (IGF-1 mediated) anabolic effects.

Mechanism of Action

Binds to GH receptors on target tissues, triggering JAK2-STAT5 signaling pathway. Direct effects include lipolysis, protein synthesis, and metabolic regulation. Indirect effects via IGF-1 promote growth and anabolism. Half-life ~3 hours subcutaneously.

01 Improved body composition (increased lean mass, decreased fat)

02 Enhanced bone mineral density

03 Improved lipid profile

04 Increased exercise capacity

05 Better quality of life and mood

06 Skin, hair, and nail improvements

07 Enhanced recovery and healing

Molecular Data

Molecular Weight

22,124 Da

Chain Length

191 amino acids

Type

Single-chain polypeptide with two disulfide bridges

Research Indications

Growth Hormone Deficiency

Pediatric GH Deficiency most effective

FDA-approved for idiopathic and organic causes, Turner syndrome, Prader-Willi syndrome, SGA, Noonan syndrome, SHOX deficiency.

Adult GH Deficiency most effective

FDA-approved for childhood-onset or adult-onset causes (pituitary tumors, surgery, radiation, trauma).

HIV-Associated Wasting effective

FDA-approved to increase lean body mass and body weight in cachexia.

Body Composition

Fat Loss effective

Significant fat loss especially abdominal/visceral fat over 1-3 months.

Lean Mass effective

Increased muscle mass and improved body composition.

Recovery Enhancement effective

Enhanced exercise recovery and tissue healing.

Anti-Aging

Skin and Hair Quality moderate

Improved skin elasticity, texture, and hair/nail growth.

Energy and Well-being moderate

Improved energy, sleep, and quality of life.

Dosing Protocols

Subcutaneous injection is the only effective route. Morning fasted injection maximizes fat-burning potential; evening mimics natural nocturnal GH pulse.

Goal	Dose	Frequency	Route
Medical GHD (Starting)	0.15-0.3mg/day (0.5-1 IU)	Once daily	SubQ
Medical GHD (Maintenance)	0.4-0.8mg/day (1.2-2.4 IU)	Once daily	SubQ
Anti-Aging/Wellness	1-2 IU/day (0.33-0.67mg)	Once daily	SubQ
Body Recomposition	2-4 IU/day (0.67-1.33mg)	Once or twice daily	SubQ
Performance (Higher Risk)	4-8 IU/day (1.33-2.67mg)	Split twice daily	SubQ

Reconstitution Instructions

Materials Needed:

HGH lyophilized powder vial (typically 10 IU or 36 IU)
Bacteriostatic water for injection
Insulin syringes (29-31 gauge)
Alcohol prep pads

1 Allow vial to reach room temperature (15-20 minutes)
2 Clean rubber stoppers with alcohol swab
3 Determine reconstitution volume (typical: 1mL BAC water per 10 IU)
4 Draw bacteriostatic water slowly, removing air bubbles
5 Insert needle at angle, aiming stream at vial wall – not directly on powder
6 Inject water slowly down inside wall, drop by drop
7 Remove needle and gently swirl in circular motion – never shake
8 Allow to sit if cloudy, then swirl again until crystal clear
9 Solution must be crystal clear; discard if cloudy or contains particles
10 Label with reconstitution date and concentration
11 Store refrigerated at 2-8°C; use within 14-28 days

Interactions

Insulin

HGH decreases insulin sensitivity; may require increased insulin doses in diabetics.

monitor

IGF-1/IGF-1 LR3

Synergistic but caution: enhanced effects with increased hypoglycemia and side effect risk.

monitor

Thyroid Hormones (T3/T4)

Increases T4 to T3 conversion; unmasks hypothyroidism in 36-47% of patients.

monitor

CJC-1295

GHRH analog can enhance effects though may be redundant with exogenous HGH.

synergistic

Ipamorelin

Ghrelin mimetic works via different pathway.

synergistic

GHRP-6/GHRP-2

Enhances natural pulsatile release.

synergistic

Cortisol/Hydrocortisone

Can unmask cortisol deficiency; replacement should precede HGH.

monitor

Testosterone

Commonly combined in hormone replacement therapy.

synergistic

Metformin

May manage insulin resistance; may reduce IGF-1 levels.

monitor

Semaglutide/Tirzepatide

GLP-1 agonists help manage insulin resistance during HGH therapy.

compatible

What to Expect

Week 1-2

Improved sleep quality, increased energy, possible water retention and joint stiffness

Week 2-4

Enhanced exercise recovery, skin improvement, possible carpal tunnel symptoms

Month 1-2

Noticeable fat loss (especially abdominal), improved skin elasticity and texture

Month 2-3

Continued fat loss, lean mass improvements, hair/nail growth, reduced recovery time

Month 3-6

Significant body composition changes, improved bone density, sustained energy/well-being

Long-term

Maintained benefits; effects diminish weeks-months after discontinuation

Side Effects & Safety

Common Side Effects

Water retention and fluid accumulation
Joint pain and stiffness
Carpal tunnel syndrome (usually resolves with dose reduction)
Headaches
Numbness/tingling in hands

Stop Signs – Discontinue if:

Severe or worsening carpal tunnel symptoms
Signs of diabetes (increased thirst, frequent urination, blurred vision)
Severe edema (facial, hand, or feet swelling)
Severe joint/muscle pain unresponsive to dose reduction
New lumps, masses, or rapidly growing moles
Severe headaches or vision changes
Signs of allergic reaction
Gynecomastia (breast tissue growth in males)
Hypothyroid symptoms (fatigue, weight gain, cold intolerance)

Contraindications

Active cancer (may accelerate tumor growth)
Acute critical illness (increased mortality in ICU patients)
Closed epiphyses in children (for growth promotion)
Pregnancy/breastfeeding

Quality Checklist

Good Signs

White to off-white lyophilized powder or solid cake (not liquid/collapsed)
Crystal clear reconstituted solution with no particles
Intact vacuum in sealed vial (resistance when inserting needle)
Pharmaceutical grade with certificate of analysis (Genotropin, Norditropin, Humatrope preferred)

Warning Signs

Generic/underground lab products have highly variable quality and potency
Common counterfeits exist; third-party testing recommended

Bad Signs

Cloudy, discolored, or particles visible indicates degradation
Powder appears melted or stuck to vial (improper storage)
Yellow/brown coloring

Frequently Asked Questions

Will HGH unmask thyroid problems?

Yes. HGH unmasks central hypothyroidism in 36-47% of users by increasing T4-to-T3 conversion. Get baseline thyroid labs (TSH, free T4, free T3) before starting and recheck at 6-8 weeks. Many users need T4 supplementation while on HGH.

How much carpal tunnel syndrome should I expect from HGH?

Carpal tunnel symptoms are common (10-30% of users) and typically mild to moderate. They usually resolve with dose reduction. Symptoms typically peak at 2-4 weeks and improve as your body adapts. Starting low and titrating up reduces risk.

Does HGH require continuous use or can I cycle it?

HGH effects are dose-dependent and reversible. Most users cycle 3-6 months on, 1-2 months off to maintain sensitivity and allow recovery of natural GH production. Continuous use is possible but may increase side effect risk over time.

Can HGH cause diabetes?

HGH decreases insulin sensitivity, potentially unmasking pre-diabetes or causing diabetes in susceptible individuals. Monitor fasting glucose and HbA1c regularly. Those with family history of diabetes should proceed cautiously and may need metformin support.

References

Long-term Safety of Growth Hormone in Adults With Growth Hormone Deficiency: Overview of 15,809 GH-Treated Patients

Stochholm K, Kiess W, Gianetti E, et al.

Journal of Clinical Endocrinology & Metabolism (2022)

15,809 patients from the KIMS database, mean 5.3 years follow-up. Adverse events in 51.2% of patients, treatment-related in 18.8%. No correlation between GH dose and adverse event rate. Supports long-term safety of GH replacement in adults with GHD.
Efficacy and Safety of Growth Hormone Treatment in Adults with Growth Hormone Deficiency: A Systematic Review of Studies on Morbidity

Defined a, Sääf M, et al.

Clinical Endocrinology (2014)

Systematic review demonstrating positive effects of GH treatment on cardiovascular disease and fracture risk, improvements in body composition, muscle strength, quality of life, bone mass/density, and lipoprotein patterns.
Cardiovascular Risk in Growth Hormone Deficiency: Beneficial Effects of Growth Hormone Replacement Therapy

Gazzaruso C, Gola M, Karamouzis I, et al.

Endocrine (2016)

GH deficiency is associated with several cardiovascular risk factors that significantly increase cardiovascular morbidity and mortality. GH replacement improves cardiovascular risk factors.
Unmasking of Central Hypothyroidism Following Growth Hormone Replacement in Adult Hypopituitary Patients

Agha A, Walker D, Perry L, et al.

Clinical Endocrinology (2007)

In 84 apparently euthyroid patients, 30 (36%) developed hypothyroidism requiring T4 therapy after starting GH. Highest risk in patients with organic pituitary disease or multiple pituitary hormone deficiencies.

Disclaimer

This information is for educational and research purposes only. Consult a healthcare professional before use.

PEPS MN / KNOWLEDGE LIBRARY

IGF-1 DES (Des(1-3) IGF-1)

Truncated IGF-1 Analog | Localized Muscle Growth

Weight: ~7,000 Da

Half-life: 20-30 minutes

Chain: 67 amino acids

4 studies

2020 latest

Limited Research

Community Research

Join others researching IGF-1 DES — share findings, ask questions, and learn from real experiences

View Results Aggregated community findings

Discussion Questions & experiences

Submit Your Findings Contribute your research data

IGF-1 DES (Des(1-3) IGF-1) is a truncated analog of insulin-like growth factor-1, missing the first three N-terminal amino acids. This structural modification eliminates binding to IGF binding proteins (IGFBPs), meaning 100% of the peptide is bioactive rather than being sequestered in circulation. The result is approximately 10x greater potency than native IGF-1, but with an extremely short half-life of 20-30 minutes. This short duration of action is considered a feature rather than a limitation — it allows for site-specific injection into target muscles immediately post-workout, promoting localized growth with reduced systemic exposure.

Mechanism of Action

IGF-1 DES activates the IGF-1 receptor (IGF-1R) and downstream PI3K/Akt/mTOR and MAPK/ERK signaling pathways, driving both muscle hypertrophy and hyperplasia. Because it lacks the tripeptide Gly-Pro-Glu at the N-terminus, it cannot bind to IGFBPs that normally sequester ~98% of circulating IGF-1. This means the entire administered dose remains bioavailable. The very short half-life confines its activity to the local injection site, where it stimulates satellite cell proliferation and differentiation, protein synthesis, and nutrient uptake in the targeted muscle tissue.

01 Approximately 10x more potent than native IGF-1

02 100% bioactive — does not bind to IGF binding proteins

03 Extremely short half-life enables localized, site-specific action

04 Promotes satellite cell activation for muscle hyperplasia

05 Minimal systemic exposure compared to IGF-1 LR3

Molecular Data

Molecular Weight

~7,000 Da

Chain Length

67 amino acids

Type

Truncated IGF-1 analog

Research Indications

Muscle Growth

Localized Hypertrophy most effective

Site-specific muscle growth via direct intramuscular injection into target muscle post-workout.

Hyperplasia effective

Stimulates satellite cell proliferation and differentiation, potentially creating new muscle fibers.

Recovery effective

Accelerates local tissue recovery in the injected muscle group after training.

Tissue Repair

Local Tissue Repair moderate

Promotes repair and regeneration at the injection site through IGF-1R activation.

Dosing Protocols

Intramuscular injection directly into the target muscle immediately post-workout. The extremely short half-life means timing and site selection are critical. Consume fast carbohydrates after injection to mitigate hypoglycemia risk.

Goal	Dose	Frequency	Route
Beginner Protocol	20-30mcg	Post-workout, injected into trained muscle	IM (site-specific)
Intermediate	30-50mcg	Post-workout, injected into trained muscle	IM (site-specific)
Advanced	50mcg	Post-workout, split across multiple trained muscles	IM (site-specific)

Reconstitution Instructions

Materials Needed:

IGF-1 DES lyophilized powder
Bacteriostatic water or 0.6% acetic acid
Insulin syringes (29-31 gauge)
Alcohol swabs

1 Allow vial to reach room temperature (15-30 min)
2 Sanitize rubber stopper with alcohol swab
3 Calculate desired concentration (e.g., 1mg in 1mL = 1000mcg/mL)
4 Inject diluent slowly along the vial wall
5 Gently swirl — do not shake
6 Allow 2-5 minutes for complete dissolution
7 Store reconstituted solution at 2-8C
8 Use within 7 days when reconstituted with BAC water
9 Acetic acid reconstitution extends stability

Interactions

Human Growth Hormone

HGH raises baseline IGF-1 levels; adding IGF-1 DES post-workout provides a localized anabolic spike on top of elevated systemic IGF-1. Use with caution and monitor blood glucose.

synergistic

IGF-1 LR3

Do not stack with IGF-1 DES. Both are IGF-1 analogs acting on the same receptor. Choose one or the other based on whether you want systemic (LR3) or localized (DES) effects.

monitor

Testosterone

Testosterone increases IGF-1 receptor density and satellite cell number, amplifying the local effects of IGF-1 DES at the injection site.

synergistic

Insulin

Both lower blood glucose. Combining IGF-1 DES with exogenous insulin significantly increases hypoglycemia risk.

avoid

What to Expect

Immediately post-injection

Localized muscle pump and fullness in the injected muscle within minutes; possible mild hypoglycemia

Week 1-2

Noticeable pump and fullness in targeted muscles on training days; localized soreness at injection site

Week 3-4

Visible improvements in targeted muscle size and shape; enhanced recovery between sessions

Post-cycle

Effects diminish rapidly due to the short-acting nature; structural gains from hyperplasia may persist

Side Effects & Safety

Common Side Effects

Hypoglycemia — consume carbohydrates after injection
Localized swelling and soreness at injection site
Increased pump in targeted muscles
Mild lightheadedness shortly after injection

Stop Signs – Discontinue if:

Severe or recurring hypoglycemia despite carbohydrate intake
Disproportionate or asymmetric muscle growth
Unusual growths, lumps, or rapid mole changes
Persistent pain, redness, or infection at injection site
Signs of systemic IGF-1 excess (jaw growth, organ enlargement)

Contraindications

Not approved for human use — research chemical only
Cancer history or active malignancy (IGF-1 promotes cell proliferation)
Diabetes or impaired glucose regulation
WADA prohibited substance — causes failed drug tests

Quality Checklist

Good Signs

HPLC purity >95%
Mass spectrometry confirmation of truncated sequence
Cold storage maintained (-20C lyophilized)
Certificate of analysis from reputable source

Warning Signs

Research chemical only — never approved for human use
No human clinical trials exist
Extremely short half-life requires precise timing

Bad Signs

Hypoglycemia risk — blood sugar can drop rapidly after injection
Potential for disproportionate muscle growth with repeated site-specific use
Black market quality varies — degraded product is common
Cancer proliferation concern — elevated IGF-1 activity promotes cell growth

Frequently Asked Questions

Why is IGF-1 DES injected directly into muscles?

IGF-1 DES has a 20-30 minute half-life and doesn’t bind IGF binding proteins, making it 10x more potent but short-acting. Direct intramuscular injection confines its activity to the targeted muscle immediately post-workout, enabling localized hypertrophy without systemic IGF-1 excess.

Will IGF-1 DES cause hypoglycemia?

Yes. IGF-1 DES lowers blood glucose by promoting glucose uptake into muscle tissue. You must consume 20-40g of fast carbohydrates immediately after injection. Monitor blood glucose early in use and never inject before sleep due to overnight hypoglycemia risk.

Can I use IGF-1 DES if I’m on a keto diet?

Not safely. The mandatory carbohydrate intake after IGF-1 DES injection will break ketosis. If keto is your goal, use alternatives like GH or ipamorelin instead. The post-injection carbs are non-negotiable for safety.

Does IGF-1 DES cause cancer risk?

IGF-1 promotes cell proliferation, and elevated systemic IGF-1 is linked to multiple cancers in the UK Biobank study. DES minimizes systemic exposure through its short half-life and local injection, but cancer risk remains a theoretical concern with any IGF-1 product.

References

The isolation and characterization of a naturally occurring truncated form of IGF-I in human brain

Sara VR, Carlsson-Skwirut C, Andersson C, Hall E, Sjogren B, Holmgren A, Jornvall H

Biochemical and Biophysical Research Communications (1986)

First identification and characterization of Des(1-3) IGF-1 as a naturally occurring truncated form of IGF-1 in human brain tissue, establishing that the N-terminal tripeptide deletion occurs endogenously.
Des(1-3)IGF-I: A truncated form of insulin-like growth factor-I that has greatly enhanced activity in promoting growth

Francis GL, Ross M, Ballard FJ, Milner SJ, Senn C, McNeil KA, Wallace JC, King R, Wells JR

Journal of Molecular Endocrinology (1992)

Des(1-3) IGF-1 demonstrated approximately 10-fold greater potency than intact IGF-1 in stimulating protein synthesis and cell proliferation, directly attributable to its inability to bind IGF binding proteins.
Insulin-like growth factor-I (IGF-I) and especially IGF-I variants are anabolic in dexamethasone-treated rats

Tomas FM, Knowles SE, Owens PC, Chandler CS, Francis GL, Read LC, Ballard FJ

Biochemical Journal (1992)

Des(1-3) IGF-1 and LR3-IGF-1 were significantly more potent than native IGF-1 in reversing dexamethasone-induced muscle wasting in rats, with truncated and modified variants showing superior anabolic activity.
Circulating Insulin-like Growth Factor-I Concentrations and Risk of 30 Cancers: Prospective Analyses in UK Biobank

Murphy N, Knuppel A, Papadimitriou N, Martin RM, Tsilidis KK, Brennan P et al.

Cancer Research (2020)

Higher circulating IGF-1 associated with increased risks of colorectal, breast, prostate, and thyroid cancers in >395,000 UK Biobank participants, underscoring the cancer risk of sustained IGF-1 pathway activation.

Disclaimer

This information is for educational and research purposes only. Consult a healthcare professional before use.

PEPS MN / KNOWLEDGE LIBRARY

IGF-1 LR3 (Long R3 IGF-1)

Modified Growth Factor Analog | Muscle Growth

Half-life: 20-30 hours

Chain: 83 amino acids

4 studies

2023 latest

2 recent

limited

Community Research

Join others researching IGF-1 LR3 — share findings, ask questions, and learn from real experiences

View Results Aggregated community findings

Discussion Questions & experiences

Submit Your Findings Contribute your research data

IGF-1 LR3 is a synthetic 83-amino acid analog of insulin-like growth factor-1 that has never been approved for human use. The N-terminal extension and R3 substitution reduce binding protein interaction, maintaining elevated free circulating levels with ~3x greater potency than native IGF-1.

Mechanism of Action

Functions as a full IGF-1 receptor agonist activating PI3K/Akt/mTOR and MAPK/ERK pathways. The modifications prevent protein sequestration, maintaining elevated free circulating levels for extended anabolic effects.

01 Approximately 3x more potent than native IGF-1

02 Promotes muscle hypertrophy and hyperplasia in animal models

03 15-20% lean mass gains observed in 4-week rat studies

04 Anti-catabolic effects preserve muscle during cachexia

05 20-30 hour half-life for sustained effects

Molecular Data

Chain Length

83 amino acids

Type

Synthetic IGF-1 analog

Research Indications

Muscle Growth

Hypertrophy most effective

15-20% lean mass gains in 4 weeks through satellite cell activation (rat studies).

Anti-Catabolic effective

Cancer cachexia rats maintained 30% more muscle versus placebo.

Hyperplasia effective

Creates new muscle fibers via satellite cell differentiation.

Tissue Repair

Wound Healing effective

Accelerated wound healing in animal models.

Ligament/Tendon Recovery moderate

Enhanced connective tissue repair.

Metabolic

Nutrient Partitioning moderate

Directs nutrients toward muscle tissue.

Fat Loss moderate

Enhanced lipolysis through IGF-1 pathway.

Dosing Protocols

Subcutaneous or intramuscular injection. CRITICAL: Consume 30-60g fast carbohydrates immediately after injection to prevent hypoglycemia. Never inject before sleep.

Goal	Dose	Frequency	Route
Beginner Protocol	20-30mcg	Once daily post-workout	SubQ/IM
Intermediate	40-60mcg	Once daily	SubQ/IM
Advanced	80-100mcg	Once or split AM/PM	SubQ/IM
Women’s Protocol	10-20mcg	Once daily	SubQ/IM

Reconstitution Instructions

Materials Needed:

IGF-1 LR3 lyophilized powder
0.6% acetic acid OR bacteriostatic water
Insulin syringes (29-32 gauge)
Alcohol swabs

1 Equilibrate to room temperature (15-30 min)
2 Sanitize rubber stopper with alcohol
3 Calculate concentration (e.g., 1mg in 2mL = 500mcg/mL)
4 Inject diluent slowly along vial wall
5 Gently swirl – never shake vigorously
6 Allow 2-5 minutes for complete dissolution
7 Store immediately at 2-8°C protected from light
8 Acetic acid reconstitution: stable 1 year
9 BAC water reconstitution: use within 7 days

Interactions

Human Growth Hormone

Creates excessive IGF-1 levels; avoid combination.

avoid

CJC-1295/Ipamorelin

Both stimulate GH/IGF-1 axis; use caution with combination.

monitor

MK-677

May compound metabolic effects through GH stimulation.

monitor

Insulin

Synergistic hypoglycemic effects can be life-threatening.

avoid

BPC-157

Complementary healing mechanisms.

synergistic

TB-500

Different repair pathway activation.

synergistic

Anabolic Steroids

Amplified effects with increased risks.

monitor

Metformin

May mitigate insulin resistance.

monitor

Cerebrolysin

Additive neurotrophic pathway effects.

monitor

What to Expect

Week 1-2

Increased muscle pump and fullness; possible hypoglycemia if carbs inadequate

Week 2-4

Enhanced recovery, strength gains, visible fullness, potential water retention

Week 4-6

Maximum effects; receptor desensitization approaching; joint stiffness common

Post-cycle

Pump loss over 1-2 weeks; strength/size gains may persist with training

Side Effects & Safety

Common Side Effects

Hypoglycemia (lasting up to 30 hours) – CRITICAL
Water retention
Joint stiffness
Muscle soreness
Increased pump during workouts

Stop Signs – Discontinue if:

Severe or recurring hypoglycemia despite carbohydrate intake
Unusual growths, lumps, or rapid mole changes
Severe joint pain or carpal tunnel symptoms
Persistent nausea, headaches, or vision changes
Signs of organ enlargement
Extreme fatigue or mental fog

Contraindications

NEVER approved for human use – research chemical only
Cancer history or undiagnosed growths
May cause organ hypertrophy (heart, intestines)
WADA prohibited – causes failed drug tests

Quality Checklist

Good Signs

HPLC purity >95%
Mass spectrometry confirmation
Cold storage maintained (-20°C lyophilized)
Certificate of analysis from reputable source

Warning Signs

Research chemical status – never approved for human use
Zero human clinical trials exist
Species-specific responses vary significantly

Bad Signs

Severe hypoglycemia risk – life-threatening low blood sugar lasting 20-30 hours
Cancer proliferation concern – UK Biobank links elevated IGF-1 to multiple cancers
Black market quality varies – oxidized and degraded forms common

Frequently Asked Questions

Why is IGF-1 LR3 called ‘long R3’?

The N-terminal extension and R3 (arginine) substitution reduce binding to IGF binding proteins, allowing the peptide to circulate freely for 20-30 hours instead of being sequestered. This gives it approximately 3x greater potency and systemic presence than native IGF-1.

Can I take IGF-1 LR3 with HGH?

Not recommended. Both are IGF-1 pathway agonists, and combining them creates excessive IGF-1 levels with amplified side effects including severe hypoglycemia, joint pain, organ enlargement risk, and carpal tunnel symptoms.

How long can I safely use IGF-1 LR3?

Maximum recommended cycle is 4-6 weeks with equal off-time. Prolonged use risks receptor desensitization, excessive organ growth, and cumulative hypoglycemia danger. Most users run 4-6 week cycles with 4-6 weeks off between.

What happens if my blood sugar drops dangerously low on IGF-1 LR3?

Severe hypoglycemia from IGF-1 LR3 can last 20-30 hours due to the long half-life. Consume 30-60g fast carbs immediately after injection and keep glucose tablets handy. Never inject before sleep. Consider having glucagon available for emergency hypoglycemia.

References

Insulin-like growth factor-I (IGF-I) and especially IGF-I variants are anabolic in dexamethasone-treated rats

Tomas FM, Knowles SE, Owens PC, Chandler CS, Francis GL, Read LC, Ballard FJ

Biochemical Journal (1992)

LR3IGF-I was approximately 2.5-fold more potent than native IGF-1 in reversing dexamethasone-induced catabolism. 7-day treatment showed significant body weight recovery vs 19g loss in controls.
Attenuated glucose-stimulated insulin secretion during an acute IGF-1 LR3 infusion into fetal sheep does not persist in isolated islets

Stremming J, White A, Galan HL, Brown LD

American Journal of Physiology – Regulatory, Integrative and Comparative Physiology (2023)

Fetal plasma insulin concentrations decreased 66% with IGF-1 LR3 infusion during hyperglycemic clamp. Insulin secretion suppression was acute and did not persist in isolated islets.
Insulin-like growth factor I preserves host lean tissue mass in cancer cachexia

Ng EH, Rock CS, Lazarus DD, Stiaino-Coico L, Moldawer LL, Bhatt GR

American Journal of Physiology (1992)

IGF-1 treatment effectively attenuated host muscle protein and lean tissue depletion in a sarcoma model without stimulating tumor growth. Dose-dependent increases in carcass weight and gastrocnemius muscle protein.
Circulating Insulin-like Growth Factor-I Concentrations and Risk of 30 Cancers: Prospective Analyses in UK Biobank

Murphy N, Knuppel A, Papadimitriou N, Martin RM, Tsilidis KK, Brennan P et al.

Cancer Research (2020)

Higher circulating IGF-1 associated with increased risks of colorectal, breast, prostate, and thyroid cancers in the UK Biobank prospective cohort of >395,000 participants.

Disclaimer

This information is for educational and research purposes only. Consult a healthcare professional before use.

PEPS MN / KNOWLEDGE LIBRARY

Ipamorelin

Growth Hormone Secretagogue | Selective GHRP

Weight: 711.85 Da

Half-life: ~2 hours

Chain: 5 amino acids

5 studies

2014 latest

1 recent

Well Studied

Community Research

Join others researching Ipamorelin — share findings, ask questions, and learn from real experiences

View Results Aggregated community findings

Discussion Questions & experiences

Submit Your Findings Contribute your research data

Selective GHRP that stimulates natural GH production from the pituitary with minimal cortisol and prolactin disruption. Known for its excellent safety profile and ability to produce consistent GH pulses without significant side effects common to other growth hormone releasing peptides.

Mechanism of Action

Binds selectively to ghrelin receptors in pituitary gland, stimulating natural GH release with direct systemic delivery via injection, consistent GH pulse stimulation, no significant cortisol or prolactin elevation, and minimal hunger response.

01 Optimal GH stimulation with superior bioavailability

02 Body composition improvements (lean mass, fat loss)

03 Enhanced recovery and anti-aging effects

04 Minimal side effects compared to other GHRPs

05 No significant cortisol or prolactin elevation

06 Improved sleep quality

Molecular Data

Molecular Weight

711.85 Da

Chain Length

5 amino acids

Type

Growth hormone secretagogue

Amino Acid Sequence

One-letter: UH????FK?

H₂N

U 1

O ‖ C

H 2

O ‖ C

? 3

O ‖ C

? 4

O ‖ C

? 5

O ‖ C

? 6

O ‖ C

F 7

O ‖ C

K 8

O ‖ C

? 9

COOH

Aib

His

Nal

Phe

Lys

NH2

N-terminus C-terminus

Hydrophobic

Polar

Positive (+)

Negative (-)

Modified

Research Indications

Growth Hormone

Natural GH Stimulation most effective

Consistent GH elevation 30-60 minutes post-injection, maintaining natural pulsatile patterns.

IGF-1 Enhancement effective

Increases insulin-like growth factor-1 through natural GH pathways.

Anti-Aging Benefits effective

Supports cellular regeneration, collagen synthesis, and tissue repair.

Body Composition

Lean Mass Development effective

Promotes muscle growth and maintenance through GH-mediated pathways.

Fat Loss Support effective

Enhances lipolysis and metabolic rate through natural GH elevation.

Recovery

Sleep Quality effective

Improved sleep latency and increased slow-wave sleep duration.

Exercise Recovery moderate

Enhanced recovery markers and reduced soreness after training.

Dosing Protocols

Most effective delivery method. Best taken on empty stomach with bedtime injection optimal for sleep benefits.

Goal	Dose	Frequency	Route
General Health & Longevity	200mcg	1x daily before bed	SubQ
Body Composition	250-300mcg	2x daily (morning, pre-workout)	SubQ
Athletic Performance	200-250mcg	2-3x daily	SubQ
Sleep & Recovery	200mcg	1x daily 30min before bed	SubQ
Anti-Aging Protocol	200-250mcg	1-2x daily	SubQ

Reconstitution Instructions

Materials Needed:

Bacteriostatic water (BAC)
Insulin syringes (0.5-1mL, 29-31 gauge)
Alcohol swabs
Sterile work surface

1 Clean work area and hands thoroughly
2 Allow refrigerated peptide to reach room temperature
3 Calculate required BAC water volume
4 Draw calculated BAC water into syringe
5 Inject BAC slowly down vial side (never directly onto powder)
6 Gently swirl until completely dissolved (never shake)
7 Store in refrigerator; use within 28 days

Interactions

CJC-1295

Extends GH release for optimal hormone cycles. Popular combination.

synergistic

BPC-157

Enhances GH receptor upregulation and effectiveness.

synergistic

TB-500

Complementary for recovery and tissue repair.

compatible

Sermorelin

Both stimulate GH; choose one to avoid receptor oversaturation.

monitor

GHRP-2

Redundant GH pathways may cause receptor desensitization.

avoid

GHRP-6

Similar mechanism with higher hunger effects; redundant.

avoid

What to Expect

Week 1-2

Improved sleep quality and morning energy

Week 2-4

Enhanced exercise recovery and reduced soreness

Week 4-8

Body composition improvements with increased lean mass

Week 8-12

Continued muscle tone, skin quality, and energy improvements

Side Effects & Safety

Common Side Effects

Mild hunger increase 20-30 minutes post-injection
Slight drowsiness when taken before bed
Water retention (mild)

Stop Signs – Discontinue if:

Signs of receptor desensitization (reduced response after 3-4 months)
Unusual joint pain or swelling
Persistent numbness or tingling

Contraindications

Pregnancy or breastfeeding
Active cancer or history of cancer
Severe kidney or liver disease

Quality Checklist

Good Signs

White, fine crystalline powder with no clumping
Clear solution after BAC water reconstitution
Mild hunger response 20-30 minutes post-injection
Slight drowsiness at bedtime doses

Warning Signs

Minimal or no physiological response after 2 weeks (check source)

Bad Signs

Yellow or discolored powder (suggests degradation)
Cloudy solution after reconstitution
No response after extended use

Frequently Asked Questions

Why do users prefer ipamorelin over other GHRPs?

Ipamorelin is the most selective GHRP—it stimulates GH release without the appetite stimulation of GHRP-6, the prolactin elevation of GHRP-2, or the cortisol/ACTH effects of hexarelin. This selectivity makes it ideal for those wanting clean GH elevation with minimal side effects.

Is ipamorelin good for bedtime dosing?

Yes, excellent. A 200mcg dose 30 minutes before bed improves sleep quality and supports the natural nocturnal GH pulse. Many users report deeper, more restorative sleep with minimal side effects compared to morning dosing.

Can I stack ipamorelin with CJC-1295?

Yes, this is a popular and synergistic combination. CJC-1295 provides baseline GH elevation while ipamorelin adds pulsatile spikes. Together they extend GH release duration and amplitude beyond either peptide alone.

How long before ipamorelin stops working?

Ipamorelin typically maintains efficacy for 3-4 months before receptor desensitization develops. Many users take 4-week breaks every 12 weeks to reset receptor sensitivity and maintain responsiveness over time.

References

Ipamorelin, the first selective growth hormone secretagogue

Raun, K., et al.

European Journal of Endocrinology (1998)

Identified ipamorelin as the first GHRP-receptor agonist with selectivity for GH release similar to GHRH. Did not release ACTH or cortisol at doses over 200-fold higher than the ED50 for GH release, distinguishing it from other secretagogues.
Pharmacokinetic-pharmacodynamic modeling of ipamorelin, a growth hormone releasing peptide, in human volunteers

Zdravkovic, M., et al.

British Journal of Clinical Pharmacology (1999)

Dose-escalation study in 40 healthy males established terminal half-life of 2 hours, clearance of 0.078 L/h/kg. Ipamorelin induced single-episode GH release peaking at 0.67 hours with dose-proportional pharmacokinetics.
Ipamorelin, a new growth-hormone-releasing peptide, induces longitudinal bone growth in rats

Johansen, P.B., et al.

Growth Hormone & IGF Research (1999)

Ipamorelin dose-dependently increased longitudinal bone growth rate from 42 to 52 mcm/day and produced pronounced dose-dependent body weight gain in adult female rats over 15 days.
The growth hormone secretagogue ipamorelin counteracts glucocorticoid-induced decrease in bone formation of adult rats

Svensson, J., et al.

Calcified Tissue International (2001)

In 8-month-old female rats treated for 3 months, ipamorelin combined with glucocorticoid increased maximum tetanic tension and periosteal bone formation rate 4-fold compared to glucocorticoid alone.
Prospective, randomized, controlled, proof-of-concept study of the ghrelin mimetic ipamorelin for the management of postoperative ileus in bowel resection patients

Greenwood-Van Meerveld, B., et al.

International Journal of Colorectal Disease (2014)

Multicenter, double-blind, placebo-controlled trial in 117 bowel resection patients. Ipamorelin 0.03 mg/kg IV twice daily for up to 7 days was well tolerated but did not significantly improve postoperative ileus outcomes versus placebo.

Disclaimer

This information is for educational and research purposes only. Consult a healthcare professional before use.

MGF (Mechano Growth Factor)

MGF (Mechano Growth Factor)

Community Research

Molecular Data

Research Indications

Dosing Protocols

Reconstitution Instructions

Interactions

What to Expect

Side Effects & Safety

Common Side Effects

Stop Signs – Discontinue if:

Contraindications

Quality Checklist

Good Signs

Warning Signs

Bad Signs

Frequently Asked Questions

Why is MGF injected directly into muscles post-workout?

How is MGF different from PEG-MGF?

Can MGF cause hypoglycemia?

How long do I need to use MGF to see muscle growth?

References

Related Peptides

Disclaimer

MK-677 (Ibutamoren)

MK-677 (Ibutamoren)

Community Research

Molecular Data

Research Indications

Dosing Protocols

Interactions

What to Expect

Side Effects & Safety

Common Side Effects

Stop Signs – Discontinue if:

Contraindications

Quality Checklist

Good Signs

Warning Signs

Bad Signs

Frequently Asked Questions

Why is MK-677 oral when most peptides are injected?

Does MK-677 increase testosterone suppression when combined with SARMs?

How much does MK-677 increase appetite?

Does MK-677 cause water retention?

References

Related Peptides

Disclaimer

PEG-MGF (Pegylated MGF)

PEG-MGF (Pegylated MGF)

Community Research

Molecular Data

Research Indications

Dosing Protocols

Reconstitution Instructions

Interactions

What to Expect

Side Effects & Safety

Common Side Effects

Stop Signs – Discontinue if:

Contraindications

Quality Checklist

Good Signs

Warning Signs

Bad Signs

Frequently Asked Questions

What makes PEG-MGF better than regular MGF for muscle recovery?

Should I inject PEG-MGF into the muscle I just trained?

Can I stack PEG-MGF with testosterone for better muscle growth?

Does PEG-MGF work for non-athletes wanting muscle maintenance?

References

Related Peptides

Disclaimer

Sermorelin (Sermorelin acetate)

Sermorelin (Sermorelin acetate)

Community Research

Molecular Data

Research Indications

Dosing Protocols