PEPS MN / МЭДЛЭГИЙН САН

MGF (Mechano Growth Factor)

Mechano Growth Factor | IGF-1 Splice Variant

Weight: ~2,888 Da

Half-life: ~5-7 minutes

Chain: 24 amino acids

2 studies

2011 latest

limited

Community Research

Join others researching MGF — share findings, ask questions, and learn from real experiences

View Results Aggregated community findings

Discussion Questions & experiences

Submit Your Findings Contribute your research data

Non-pegylated IGF-1 splice variant produced locally in muscle tissue following mechanical stress. Has a very short half-life compared to PEG-MGF, requiring more frequent administration or localized injection.

Mechanism of Action

Activates muscle satellite stem cells via receptor binding, stimulating MAPK/ERK signaling. Enhances protein synthesis and promotes muscle fiber repair. The E-peptide domain exhibits distinct activity from mature IGF-1.

01 Satellite cell activation for muscle repair

02 Recovery support following mechanical stress

03 Localized tissue regeneration

04 Natural upregulation after exercise

Molecular Data

Molecular Weight

~2,888 Da

Chain Length

24 amino acids

Type

IGF-1Ec splice variant C-terminal peptide

Amino Acid Sequence

YQPPSTNKNTKSQRRKGSTFEEHK

Complex or non-standard sequence format

Research Indications

Muscle Repair

Satellite Cell Activation most effective

Primary mechanism activating dormant muscle satellite cells which fuse to damaged fibers.

Local Muscle Recovery effective

Short half-life means effects are concentrated at injection site.

Post-Exercise Recovery effective

Naturally upregulated after mechanical stress; supplementation enhances repair processes.

Tissue Regeneration

Tendon Healing moderate

Animal studies suggest improved tendon injury outcomes when applied locally.

Bone Regeneration moderate

Research indicates potential for bone healing via osteoblast regulation.

Dosing Protocols

Intramuscular injection directly into target muscle immediately post-workout for localized effects due to short half-life.

Goal	Dose	Frequency	Route
Standard Protocol	100-300mcg	Daily, post-workout	IM into target muscle
Progressive Titration	100mcg → 300mcg	Daily, increasing weekly	IM bilateral
Localized Recovery	200-300mcg	Immediately post-workout	IM into worked muscle groups

Reconstitution Instructions

Materials Needed:

MGF lyophilized powder (typically 5mg vial)
Bacteriostatic water (3.0mL recommended)
Insulin syringes (29-31 gauge)
Alcohol swabs

1 Allow vial to reach room temperature
2 Clean rubber stopper with alcohol swab
3 Add 3.0mL bacteriostatic water for ~1.67mg/mL concentration
4 Inject slowly along vial wall, not directly onto powder
5 Gently swirl to dissolve; never shake
6 Store refrigerated at 2-8°C
7 Use within 30 days of reconstitution

Interactions

PEG-MGF

Same active peptide with different half-lives. Combining is redundant; choose one based on protocol preference.

monitor

IGF-1 LR3

Both target IGF-1 pathways; combining risks receptor overstimulation.

monitor

BPC-157

Complementary mechanisms. BPC-157 promotes angiogenesis; MGF activates satellite cells.

synergistic

TB-500

TB-500 reduces inflammation and promotes cell migration; MGF activates muscle stem cells.

synergistic

What to Expect

Immediate

Very short half-life means localized effects at injection site within minutes

Week 1-2

Reduced muscle soreness in targeted areas; subtle recovery improvements

Week 4-8

Improved recovery in targeted muscles; enhanced training capacity

Side Effects & Safety

Common Side Effects

Injection site soreness
Mild fatigue

Stop Signs – Discontinue if:

Any unusual growths, lumps, or rapid tissue changes
Severe injection site reactions
Persistent headaches or vision changes
Signs of hypoglycemia

Contraindications

Any history of cancer or neoplastic disease
Pregnancy or breastfeeding
Uncontrolled diabetes

Quality Checklist

Good Signs

White or off-white fluffy cake appearance
Crystal clear solution after reconstitution
Certificate of Analysis with HPLC purity >98%

Warning Signs

Minor clumping that dissolves with gentle swirling

Bad Signs

Collapsed or discolored powder
Persistent cloudiness or visible particles

Frequently Asked Questions

Why is MGF injected directly into muscles post-workout?

MGF has a 5-7 minute half-life and activates satellite stem cells locally at the injection site. Post-workout timing is critical because muscles are primed for growth and recovery. Direct intramuscular injection confines effects to the trained muscle group you want to develop.

How is MGF different from PEG-MGF?

Standard MGF has a 5-7 minute half-life requiring daily injections. PEG-MGF (pegylated) lasts much longer (hours). Choose based on protocol preference: frequent localized doses (MGF) or fewer higher-dose injections (PEG-MGF). Effects are similar; administration differs.

Can MGF cause hypoglycemia?

Possibly, though less likely than IGF-1 LR3 due to MGF’s very short half-life and localized action. However, the post-workout window and direct muscle injection make hypoglycemia unlikely. Still monitor early use and consume carbs post-injection as a precaution.

How long do I need to use MGF to see muscle growth?

Week 1-2 shows reduced soreness in targeted muscles. Week 4-8 shows noticeable improvements in trained muscle size and recovery capacity. Most users run 8-12 week cycles with equal off-time. Structural gains from satellite cell activation may persist after discontinuation.

References

MGF-E Peptide Human Muscle Cell Study

(2011)

MGF significantly increased satellite cell proliferation at 3ng/ml with age-dependent effects.
Mechano-Growth Factor Minireview

(2010)

Overview of MGF as IGF-I gene product involved in tissue repair, upregulated following exercise and injury.

Disclaimer

This information is for educational and research purposes only. Consult a healthcare professional before use.

PEPS MN / МЭДЛЭГИЙН САН

MK-677 (Ibutamoren)

Ghrelin Receptor Agonist | Oral Growth Hormone Secretagogue

Weight: 624.77 Da

Half-life: ~24 hours

7 studies

2008 latest

3 recent

Well Studied

Community Research

Join others researching MK-677 — share findings, ask questions, and learn from real experiences

View Results Aggregated community findings

Discussion Questions & experiences

Submit Your Findings Contribute your research data

Oral compound activating ghrelin receptors to trigger growth hormone release while preserving natural production. Achieves superior oral bioavailability exceeding 60% with a 24-hour half-life, making it unique among GH secretagogues for its convenient once-daily oral dosing.

Mechanism of Action

Selectively binds GHS-R1a receptors in hypothalamus and pituitary, triggering pulsatile growth hormone release while maintaining natural circadian patterns.

01 97% increase in 24-hour growth hormone secretion

02 40-72% elevation in IGF-1 levels

03 Enhanced sleep quality with improved REM patterns

04 Preferential lean tissue gains of 1.1-2.7kg over 8-12 months

05 15% basal metabolic rate increase within 2 weeks

06 Oral administration (no injections required)

Molecular Data

Molecular Weight

624.77 Da

Type

Non-peptide ghrelin receptor agonist

Research Indications

Growth Hormone

GH Restoration most effective

Restores youthful growth hormone levels in elderly subjects with 97% increase in 24-hour secretion.

IGF-1 Enhancement most effective

Sustained 40-72% IGF-1 elevation over extended periods.

Sleep Enhancement effective

20% REM increase in younger adults; 50% improvement in elderly.

Body Composition

Muscle Preservation most effective

Demonstrates +2.69g/day nitrogen retention versus -8.97g/day placebo, protecting lean mass during caloric restriction.

Fat-Free Mass effective

Increases fat-free mass with preferential lean tissue accrual.

Metabolic Rate effective

15% basal metabolic rate elevation documented at 2 weeks.

Bone Health

Bone Formation effective

39-45% increase in bone formation markers within 6-8 weeks.

Dosing Protocols

Optimal bioavailability eliminates injection requirements with convenient daily dosing. Take at bedtime on empty stomach for best results.

Goal	Dose	Frequency	Route
Body composition/anti-aging	25mg	1x daily	Oral (bedtime, empty stomach)
Sleep quality improvement	25mg	1x nightly	Oral (30 minutes before bed)
Conservative initiation	12.5mg	1x daily	Oral (assess tolerance)

Interactions

CJC-1295

Complementary GH pathways providing combined pulsatile and baseline elevation.

synergistic

Ipamorelin

Both stimulate GH release through different mechanisms.

synergistic

GHRP-2

MK-677 baseline elevation combines with GHRP-2 pulsatile spikes.

synergistic

TB-500

Non-competing mechanisms enhancing recovery effects.

compatible

BPC-157

Systemic growth factors complement localized healing.

compatible

HGH

Redundant effects without proportional benefits.

avoid

Insulin

MK-677 decreases insulin sensitivity; requires blood glucose monitoring.

monitor

LGD-4033

Case report documents 85.7% testosterone suppression and significant liver enzyme elevation when combined.

monitor

What to Expect

Week 1-2

Improved sleep quality, vivid dreams, possible appetite increase

Week 2-4

Enhanced recovery, better sleep architecture, initial body composition changes

Week 4-8

Noticeable lean mass gains, continued sleep benefits

Week 8-12

Maximum body composition improvements, sustained GH elevation

Side Effects & Safety

Common Side Effects

Appetite stimulation (>50% of users)
Water retention (30-40%)
Lethargy (20-30%)
Fasting glucose elevation (5-15mg/dL)
Note on testosterone suppression: at doses up to 20 mg daily, MK-677 is unlikely to cause significant testosterone suppression on its own. Above 20 mg daily, the likelihood of suppression and other side effects (insulin resistance, water retention, lethargy) increases. The case report documenting 85.7% testosterone suppression involved co-administration with LGD-4033, a SARM known to be profoundly suppressive, making the SARM the likely primary driver of that suppression.

Stop Signs – Discontinue if:

Shortness of breath, chest pain, or unusual fatigue
Blood glucose levels >100mg/dL or diabetes symptoms
Liver enzyme elevation (ALT/AST >2x upper normal)
Severe fluid retention or unexplained swelling
Any concerning cardiovascular symptoms

Contraindications

Heart disease or congestive heart failure
Diabetes or pre-diabetes
Active cancer
Severe cardiovascular disease
Pregnancy or breastfeeding

Quality Checklist

Good Signs

Pharmaceutical-grade capsules with professional labeling
Batch numbers and expiration dates
Third-party testing documentation
Certificate of analysis showing >98% purity

Warning Signs

Products labeled ‘for research only’ may lack quality control

Bad Signs

Dietary supplement claims (FDA prohibits MK-677 in supplements)
Unknown purity or source without certificates of analysis
Unusually low prices suggesting counterfeit product

Frequently Asked Questions

Why is MK-677 oral when most peptides are injected?

MK-677 is not actually a peptide—it’s a small-molecule non-peptide ghrelin receptor agonist with excellent oral bioavailability (>60%) and a 24-hour half-life. This allows convenient once-daily oral dosing without injections, making it uniquely practical among GH secretagogues.

Does MK-677 increase testosterone suppression when combined with SARMs?

At doses up to 20mg daily, MK-677 alone causes minimal testosterone suppression. However, one case report documented 85.7% testosterone suppression when combined with LGD-4033 (a SARM). The SARM was likely the primary driver of suppression, not MK-677.

How much does MK-677 increase appetite?

Appetite stimulation affects >50% of users at 25mg doses. This is direct ghrelin mimicry—the same mechanism that increases GH. If appetite stimulation is problematic, reduce dose to 12.5mg or use ipamorelin instead for cleaner GH elevation without hunger.

Does MK-677 cause water retention?

Yes. 30-40% of users experience water retention from MK-677’s GH stimulation and sodium retention effects. This appears within the first 2-4 weeks. Sodium management and adequate hydration help minimize bloating, and effects often diminish over time as the body adapts.

References

Effects of a 7-day treatment with a novel, orally active, growth hormone (GH) secretagogue, MK-677, on 24-hour GH profiles, insulin-like growth factor I, and adrenocortical function in normal young men

Copinschi, G., et al.

Journal of Clinical Endocrinology & Metabolism (1996)

Randomized, double-blind crossover in 9 healthy young men. 7-day oral MK-677 (5 and 25mg) increased 24-hour GH profiles dose-dependently while preserving circadian patterns.
Stimulation of the growth hormone (GH)-insulin-like growth factor I axis by daily oral administration of a GH secretagogue (MK-677) in healthy elderly subjects

Chapman, I.M., et al.

Journal of Clinical Endocrinology & Metabolism (1996)

Randomized, double-blind trial in 32 elderly subjects (64-81 years). 25mg/day MK-677 for up to 4 weeks increased mean 24-hour GH by 97% and restored IGF-I concentrations to young adult levels.
Prolonged oral treatment with MK-677, a novel growth hormone secretagogue, improves sleep quality in man

Copinschi, G., et al.

Neuroendocrinology (1997)

In young adults, 25mg MK-677 increased stage IV sleep duration by 50% and REM sleep by 20%. In older adults, REM sleep increased nearly 50% with decreased REM latency. Sleep deviations dropped from 42% to 8%.
MK-677, an orally active growth hormone secretagogue, reverses diet-induced catabolism

Murphy, M.G., et al.

Journal of Clinical Endocrinology & Metabolism (1998)

Double-blind crossover in 8 healthy volunteers under caloric restriction. 25mg/day MK-677 for 7 days reversed nitrogen wasting (+2.69g/day vs -8.97g/day placebo) and significantly increased IGF-I.
Two-month treatment of obese subjects with the oral growth hormone (GH) secretagogue MK-677 increases GH secretion, fat-free mass, and energy expenditure

Chapman, I.M., et al.

Journal of Clinical Endocrinology & Metabolism (1998)

24 obese males treated with 25mg/day for 8 weeks showed sustained increases in GH, IGF-I, fat-free mass, and a transient increase in basal metabolic rate at 2 weeks.
Oral administration of the growth hormone secretagogue MK-677 increases markers of bone turnover in healthy and functionally impaired elderly adults

Murphy, M.G., et al.

Journal of Bone and Mineral Research (1999)

187 elderly adults (65+) across three placebo-controlled studies. 9 weeks of MK-677 increased serum osteocalcin by 29.4%, bone-specific alkaline phosphatase by 10.4%, and urinary NTX by 22.6%.
Effects of an oral ghrelin mimetic on body composition and clinical outcomes in healthy older adults: a randomized trial

Nass, R., et al.

Annals of Internal Medicine (2008)

12-month RCT in 65 healthy adults (60-81 years). MK-677 increased GH and IGF-I to young adult levels, increased fat-free mass while placebo group declined, and was generally well tolerated.

Disclaimer

This information is for educational and research purposes only. Consult a healthcare professional before use.

PEPS MN / МЭДЛЭГИЙН САН

PEG-MGF (Pegylated MGF)

Pegylated Mechano Growth Factor | IGF-1 Splice Variant

Weight: ~2,888 Da

Half-life: 48-72 hours (via PEGylation)

Chain: 24 amino acids

3 studies

2018 latest

limited

Community Research

Join others researching PEG-MGF — share findings, ask questions, and learn from real experiences

View Results Aggregated community findings

Discussion Questions & experiences

Submit Your Findings Contribute your research data

Modified IGF-1 variant with PEG attachment extending half-life from minutes to hours. Activates muscle satellite cells following mechanical stress or injury.

Mechanism of Action

Activates muscle satellite stem cells via receptor binding, stimulating MAPK/ERK signaling. Enhances protein synthesis and promotes muscle fiber repair. E-peptide domain exhibits distinct activity from mature IGF-1.

01 Extended half-life through PEGylation

02 Satellite cell activation for muscle repair

03 Recovery support following mechanical stress

04 Potential neuroprotection against oxidative stress

Molecular Data

Molecular Weight

~2,888 Da

Chain Length

24 amino acids

Type

IGF-1Ec splice variant C-terminal peptide

Amino Acid Sequence

YQPPSTNKNTKSQRRKGSTFEEHK

Complex or non-standard sequence format

Research Indications

Muscle Repair

Satellite Cell Activation most effective

Primary mechanism activating dormant muscle satellite cells which fuse to damaged fibers.

Delayed Senescence effective

Increases proliferative lifespan in younger muscle progenitor cells.

Enhanced Fusion Potential effective

Increases activated satellite cell fusion capacity supporting repair and hypertrophy.

Tissue Regeneration

Tendon Healing effective

Animal studies suggest improved Achilles tendon injury outcomes.

Bone Regeneration moderate

Rabbit models demonstrated faster healing via osteoblast regulation.

Cartilage Repair moderate

Research indicates potential for articular cartilage injury models.

Recovery

Exercise Recovery moderate

Naturally upregulated after mechanical stress; supplementation may enhance processes.

Injury Recovery effective

Localized injection near injury sites supports targeted tissue repair.

Dosing Protocols

Subcutaneous or intramuscular administration; post-workout timing aligns with natural MGF upregulation.

Goal	Dose	Frequency	Route
General Recovery	200mcg	2-3x weekly	SubQ or IM
Targeted Muscle Recovery	200-400mcg	Post-workout, 2-3x weekly	IM bilateral near target muscle
Injury Recovery	200-400mcg	2-3x weekly	IM near injury site
Conservative Protocol	100-200mcg	2x weekly	SubQ

Reconstitution Instructions

Materials Needed:

PEG-MGF lyophilized powder (typically 2mg vial)
Bacteriostatic water
Insulin syringes (29-31 gauge)
Alcohol swabs

1 Allow vial to reach room temperature
2 Clean rubber stopper with alcohol swab
3 Draw appropriate bacteriostatic water amount
4 Inject slowly along vial wall, not directly onto powder
5 Gently swirl to dissolve; never shake
6 Allow 2-5 minutes for full dissolution
7 Store refrigerated at 2-8°C
8 Protect from light

Interactions

IGF-1 LR3

Both target IGF-1 pathways; combining risks receptor overstimulation. Reduce doses significantly if combined.

monitor

Human Growth Hormone

HGH increases endogenous IGF-1/MGF. Combined use amplifies effects but monitor for excessive water retention and joint pain.

monitor

BPC-157

Complementary mechanisms. BPC-157 promotes angiogenesis; PEG-MGF activates satellite cells. Popular recovery stack.

synergistic

TB-500

TB-500 reduces inflammation and promotes cell migration; PEG-MGF activates muscle stem cells.

synergistic

Insulin

Both affect glucose metabolism. Monitor blood sugar carefully if combined.

monitor

Thymosin Beta-4

Different regenerative pathways may enhance tissue repair through multiple mechanisms.

synergistic

What to Expect

Week 1-2

Reduced muscle soreness post-workout; subtle recovery improvements

Week 2-4

Enhanced recovery between training; potential injury-related discomfort reduction

Week 4-8

Optimal muscle repair effects; improved training capacity from better recovery

Post-cycle

Benefits persist several weeks as tissue repair continues

Side Effects & Safety

Common Side Effects

Injection site soreness
Mild fatigue

Stop Signs – Discontinue if:

Any unusual growths, lumps, or rapid tissue changes
Severe injection site reactions beyond normal soreness
Persistent headaches or vision changes
Signs of hypoglycemia
Unexpected swelling or edema

Contraindications

Any history of cancer or neoplastic disease
Pregnancy or breastfeeding
Uncontrolled diabetes or severe hyperglycemia

Quality Checklist

Good Signs

White or off-white fluffy cake appearance indicates proper freeze-drying
Crystal clear solution after reconstitution with no particles
Certificate of Analysis with HPLC purity testing (>98%)

Warning Signs

Minor clumping that dissolves with gentle swirling is normal

Bad Signs

Collapsed or discolored powder suggests heat degradation
Persistent cloudiness or visible particles indicate contamination

Frequently Asked Questions

What makes PEG-MGF better than regular MGF for muscle recovery?

PEGylation extends the half-life from minutes to 48-72 hours, meaning you don’t need to inject as frequently and the peptide stays active longer in your system. Regular MGF has a very short half-life, limiting recovery window. PEG-MGF’s extended duration allows for deeper satellite cell activation and sustained muscle repair.

Should I inject PEG-MGF into the muscle I just trained?

Yes, localized injection near or into the damaged muscle is optimal. The file specifically lists ‘IM bilateral near target muscle’ for targeted recovery. Post-workout timing (within 1-2 hours) aligns with when your body naturally upregulates MGF, making that the ideal window for injection.

Can I stack PEG-MGF with testosterone for better muscle growth?

There’s no direct contraindication, but be cautious. PEG-MGF activates satellite cells (muscle stem cells) while testosterone increases protein synthesis and hormonal signals. The combination might work synergistically, but monitor for excessive water retention and joint pain, which can occur with combined growth-promoting agents.

Does PEG-MGF work for non-athletes wanting muscle maintenance?

Possibly, but PEG-MGF is most effective when there’s mechanical stress or injury to trigger satellite cell activation. Without training stimulus or injury, it won’t dramatically build muscle. It’s better for accelerating recovery after workouts or helping with injury rehabilitation rather than standalone muscle building.

References

MGF-E Peptide Human Muscle Cell Study

(2011)

Landmark study demonstrating MGF significantly increased satellite cell proliferation at 3ng/ml (P<0.001) with age-dependent effects.
MGF Inflammatory Response Study

(2018)

MGF overexpression modulated inflammatory cytokines and enhanced macrophage resolution during skeletal muscle injury recovery.
Mechano-Growth Factor Minireview

(2010)

Overview of MGF as IGF-I gene product involved in tissue repair, highlighting upregulation following exercise and injury.

Disclaimer

This information is for educational and research purposes only. Consult a healthcare professional before use.

PEPS MN / МЭДЛЭГИЙН САН

Sermorelin (Sermorelin acetate)

GHRH Analog | Growth Hormone Releasing Hormone

Weight: 3,358 Da

Half-life: 10-12 minutes

Chain: 29 amino acids

5 studies

2006 latest

1 recent

Well Studied

Community Research

Join others researching Sermorelin — share findings, ask questions, and learn from real experiences

View Results Aggregated community findings

Discussion Questions & experiences

Submit Your Findings Contribute your research data

Sermorelin is a synthetic 29-amino acid analog of human growth hormone-releasing hormone that stimulates natural growth hormone production while preserving physiological pulsatile patterns. Originally FDA-approved in 1997 for pediatric GH deficiency, it was discontinued in 2008 for manufacturing reasons, not safety concerns.

Mechanism of Action

Subcutaneous injection provides optimal bioavailability for binding GHRH receptors, stimulating pulsatile GH release while maintaining hypothalamic-pituitary axis integrity and allowing natural somatostatin negative feedback.

01 FDA-proven efficacy

02 Maintains natural GH pulsatile patterns

03 Preserves pituitary function

04 1.26kg lean mass increase documented in elderly

05 IGF-1 mediated anabolic effects

06 Allows natural feedback regulation

Molecular Data

Molecular Weight

3,358 Da

Chain Length

29 amino acids

Type

GHRH analog

Research Indications

Muscle Growth

Lean Body Mass Enhancement most effective

1.26kg lean mass increase documented in elderly men with improved muscle strength tests.

IGF-1 Mediated Growth effective

Endogenous IGF-1 stimulation drives protein synthesis and muscle growth.

Athletic Recovery effective

Enhanced recovery through physiological GH stimulation.

Anti-Aging

Age-Related GH Decline Reversal effective

Doubles 12-hour GH release in elderly subjects over 6 weeks.

Body Composition Improvement effective

Decreased adiposity and improved lean mass distribution.

Skin Quality Enhancement moderate

Improved skin thickness and quality.

Hormonal

Endogenous GH Stimulation moderate

Preserves natural axis function without suppression.

Natural Pulsatile Secretion moderate

Maintains physiological GH release patterns.

Dosing Protocols

Subcutaneous injection is the primary method. Bedtime administration aligns with natural nocturnal GH pulses. Avoid food 2+ hours before injection as carbohydrates blunt GH response.

Goal	Dose	Frequency	Route
Anti-aging/Longevity	200-300mcg	Once at bedtime	SubQ
Athletic Performance	300-500mcg	Once at bedtime	SubQ
Body Composition	200mcg	5 days weekly	SubQ
Combination Therapy	200mcg + GHRP	Once daily	SubQ co-injection

Reconstitution Instructions

Materials Needed:

Sermorelin acetate lyophilized powder (2-5mg vial)
Bacteriostatic water for injection (3mL)
Insulin syringes (28-30 gauge)
Alcohol swabs

1 Allow vial to reach room temperature
2 Clean vial top with alcohol swab; allow to dry
3 Inject 3mL bacteriostatic water slowly against vial wall (not directly on powder)
4 Gently swirl in circular motion – do not shake vigorously
5 Allow 2-3 minutes until powder dissolves into clear solution
6 Store reconstituted solution at 2-8°C; use within 10-30 days
7 Inject subcutaneously at 45-degree angle; rotate sites

Intranasal spray is available with 69% patient preference over injection. Lower bioavailability but bypasses first-pass metabolism.

Goal	Dose	Frequency	Route
Nasal administration	30+ mcg/kg	Once daily at bedtime	Nasal spray

Interactions

Ipamorelin

Excellent combination producing 3-5 fold increases in GH release.

synergistic

CJC-1295

Highly effective combination – CJC-1295 provides sustained 6-8 day release while sermorelin offers immediate pulsatile effects.

synergistic

GHRP-2

Combined GHRH+GHRP-2 produces 54-fold GH increases compared to 20-fold with GHRH alone.

synergistic

Octreotide/Lanreotide

Somatostatin analogs directly block GH release by activating inhibitory receptors.

avoid

Prednisone

High-dose glucocorticoids suppress pituitary GH release and reduce GHRH receptor sensitivity.

monitor

Insulin

GH antagonizes insulin action; monitor combination closely.

monitor

Thyroid Hormones

Essential combination as untreated hypothyroidism prevents sermorelin response.

compatible

What to Expect

Week 1-2

IGF-1 elevation begins; improved sleep quality and recovery

Week 2-4

Body composition changes begin; increased energy and well-being

Week 4-8

Visible muscle tone improvements; fat reduction; skin quality enhancement

Week 8-12

Sustained improvements; optimal IGF-1 elevation

Month 3-6

Maximum benefits: muscle growth, fat loss, anti-aging effects

Side Effects & Safety

Common Side Effects

Injection site reactions (16.7% of patients – generally mild)
Nasal irritation (intranasal route)

Stop Signs – Discontinue if:

Signs of pituitary tumor growth (headaches, vision changes)
Severe injection site reactions or generalized allergic responses
Uncontrolled diabetes or significant glucose intolerance
New onset or worsening malignancy symptoms

Contraindications

Active malignancy
Pituitary tumors
Pregnancy

Quality Checklist

Good Signs

Completely clear and colorless solution without particles, cloudiness, or precipitation
Greater than 98% peptide purity per USP standards
Sterile, nonpyrogenic lyophilized powder
Maintained at 2-8°C throughout transport
Produced in FDA-registered facilities following cGMP

Warning Signs

Brief room temperature exposure acceptable up to 72 hours but should be refrigerated promptly

Bad Signs

Any cloudiness, particles, color changes, or precipitation indicates degradation
Molecular weight should be exactly 3,358 daltons (free base) or 3,418 daltons (acetate salt)

Frequently Asked Questions

Why was sermorelin discontinued if it was FDA-approved and safe?

Sermorelin was discontinued in 2008 for manufacturing reasons, not safety concerns. It was approved in 1997 and had a solid safety record, but the manufacturer stopped production. This left a gap in the market—sermorelin is now available through research/compounded sources but not as a branded pharmaceutical.

How does sermorelin preserve natural GH patterns better than taking GH directly?

Sermorelin stimulates your pituitary to release GH in its natural pulsatile pattern (high at night, low during day). Direct GH injection creates constant levels, suppressing your natural axis. Sermorelin preserves the hypothalamic-pituitary-axis (HPA) feedback loop, meaning you maintain natural regulation rather than becoming dependent on external hormones.

Why shouldn’t I eat food 2+ hours before sermorelin injection?

Carbohydrates and high blood sugar suppress GH release. Eating before injection blunts your GH response by 50-80%, making the injection ineffective. Bedtime administration on an empty stomach ensures maximum GH secretion from the natural nocturnal pulse your body is primed to produce.

Can I combine sermorelin with GHRP-2 for even bigger GH increases?

Yes, and it’s highly effective. GHRH + GHRP-2 combination produces 54-fold GH increases vs 20-fold with GHRH alone. However, start cautiously and monitor for joint pain/water retention. The synergy is excellent for body composition but requires more careful dose management than either alone.

References

The effects of intranasal insufflation of growth hormone releasing factor analogue GRF 1-29 NH2 on growth hormone secretion in children with short stature

Laron, Z., et al.

Clinical Endocrinology (1988)

Intranasal GRF 1-29 at 100mcg/kg induced prompt GH release in prepubertal children with peak values at 15 minutes. Demonstrated feasibility of nasal delivery with minimal side effects.
Growth hormone (GH)-releasing hormone-(1-29) twice daily reverses the decreased GH and insulin-like growth factor-I levels in old men

Corpas, E., et al.

Journal of Clinical Endocrinology & Metabolism (1992)

Landmark study in healthy old men (68 +/- 6.2 yr). High-dose GHRH(1-29) twice daily for 14 days reversed age-related decreases in GH and IGF-I to levels not significantly different from young men.
Once daily subcutaneous growth hormone-releasing hormone therapy accelerates growth in growth hormone-deficient children during the first year of therapy

Geref International Study Group

Journal of Clinical Endocrinology & Metabolism (1996)

Pivotal multicenter trial with 110 prepubertal GH-deficient children. Sermorelin 30mcg/kg/day at bedtime increased height velocity from 4.1 to 8.0 cm/year at 6 months, with 74% achieving good response.
Endocrine and metabolic effects of long-term administration of [Nle27]growth hormone-releasing hormone-(1-29)-NH2 in age-advanced men and women

Vittone, J., et al.

Journal of Clinical Endocrinology & Metabolism (1997)

5-month single-blind RCT in 19 adults (55-71 yr). Nightly GHRH analog for 4 months activated somatotropic axis. Men showed increased lean body mass, insulin sensitivity, and well-being. Skin thickness improved in both genders.
Sermorelin: a better approach to management of adult-onset growth hormone insufficiency?

Walker, R.F.

Clinical Interventions in Aging (2006)

Review arguing sermorelin preserves pituitary function and physiological GH pulsatility, offering a safer alternative to exogenous GH for adult-onset GH insufficiency.

Disclaimer

This information is for educational and research purposes only. Consult a healthcare professional before use.

PEPS MN / МЭДЛЭГИЙН САН

Tesa/IPA протокол (Tesa-IPA)

Tesa/IPA Protocol (Tesa-IPA)

Tesamorelin + Ipamorelin GH Secretagogue Blend

4 studies

2024 latest

3 recent

Limited Research

Community Research

Join others researching Tesa/IPA Protocol — share findings, ask questions, and learn from real experiences

View Results Aggregated community findings

Discussion Questions & experiences

Submit Your Findings Contribute your research data

The Tesa/IPA blend combines two complementary growth hormone secretagogues: Tesamorelin (a GHRH analog that stimulates GH release from the pituitary) and Ipamorelin (a selective ghrelin mimetic/GHRP that amplifies GH pulses). This combination addresses both the GHRH and GHRP pathways for synergistic GH release. Common formulations include 5mg/5mg (1:1 ratio) and 10mg/3mg (higher Tesamorelin) variants. Tesamorelin is FDA-approved for HIV-associated lipodystrophy, while Ipamorelin remains investigational.

Mechanism of Action

The blend leverages two distinct GH-releasing pathways: Tesamorelin is a synthetic GHRH analog that directly stimulates growth hormone-releasing hormone receptors on pituitary somatotrophs, triggering GH synthesis and secretion in a pulsatile, physiological manner. Ipamorelin is a selective ghrelin receptor (GHS-R1a) agonist that amplifies GH pulses without significantly affecting cortisol or prolactin. Together, they produce synergistic GH release greater than either compound alone, while maintaining the body’s natural feedback mechanisms.

01 Synergistic GH release from dual pathways

02 More physiological pulsatile GH secretion

03 Tesamorelin’s proven lipodystrophy benefits

04 Ipamorelin’s clean side effect profile

05 Does not significantly affect cortisol or prolactin

06 Single injection convenience

07 May improve body composition, sleep, and recovery

Molecular Data

Type

Dual GH secretagogue combination

Amino Acid Sequence

Tesamorelin (GHRH analog) + Ipamorelin (GHRP)

Complex or non-standard sequence format

Research Indications

Body Composition

Fat Reduction effective

Tesamorelin has demonstrated fat reduction in clinical trials; synergy with Ipamorelin may enhance effects.

Visceral Fat Loss most effective

Tesamorelin specifically reduces visceral adipose tissue (FDA-approved indication).

Lean Mass Support moderate

Enhanced GH promotes protein synthesis and lean tissue preservation.

Recovery & Wellness

Sleep Quality effective

GH secretagogues often improve deep sleep quality.

Recovery Enhancement moderate

Enhanced GH supports tissue repair and recovery from exercise.

Anti-Aging Support moderate

Restoring more youthful GH levels may provide anti-aging benefits.

Metabolic Health

Lipid Profile moderate

Tesamorelin has shown improvements in lipid parameters in studies.

IGF-1 Optimization effective

Increased GH leads to increased IGF-1 production.

Dosing Protocols

Subcutaneous injection, typically administered before bed or in the morning on an empty stomach. Evening dosing may enhance natural nighttime GH pulse. Avoid eating 2-3 hours before and 30-60 minutes after injection for optimal results.

Goal	Dose	Frequency	Route
Standard protocol (5/5 blend)	200-400mcg total	Once daily (evening)	SubQ
Enhanced protocol (10/3 blend)	300-500mcg total	Once daily (evening)	SubQ
Twice daily (advanced)	200-300mcg per dose	Morning and evening	SubQ

Reconstitution Instructions

Materials Needed:

Tesa/IPA vial (5/5mg or 10/3mg)
Bacteriostatic water (2-3mL)
Insulin syringes
Alcohol prep pads

1 Clean vial top with alcohol pad
2 Add 2mL bacteriostatic water for convenient dosing
3 Gently swirl – do not shake
4 Solution should appear clear
5 Label with date and concentration
6 Store refrigerated immediately
7 Use within 4-6 weeks

Interactions

Tesamorelin (standalone)

Already contains Tesamorelin – do not add more.

avoid

Ipamorelin (standalone)

Already contains Ipamorelin – do not add more.

avoid

CJC-1295

Both Tesamorelin and CJC-1295 are GHRH analogs; combining may cause excessive stimulation.

monitor

GHRP-6/GHRP-2

Already has GHRP pathway covered by Ipamorelin; adding more GHRPs may be excessive.

monitor

MK-677

Both affect GH release; combination may be excessive and affect glucose.

monitor

BPC-157

Different mechanisms; can complement for healing with GH support.

compatible

Semaglutide

Different pathways; some combine for body composition goals.

compatible

Insulin

GH affects glucose metabolism; diabetics should monitor carefully.

monitor

What to Expect

Week 1-2

Improved sleep quality often noticed first; initial GH response

Week 2-4

Enhanced recovery; subtle body composition changes beginning

Week 4-8

Noticeable fat loss (especially visceral); improved energy

Week 8-16

Full body composition benefits; continued improvements

Side Effects & Safety

Common Side Effects

Injection site reactions (redness, itching)
Water retention (usually transient)
Tingling or numbness in extremities
Joint stiffness
Increased hunger (Ipamorelin effect)

Stop Signs – Discontinue if:

Severe injection site reactions
Significant swelling or edema
Signs of glucose dysregulation
Severe joint pain
Allergic reactions

Contraindications

Active malignancy (GH may promote tumor growth)
Diabetic retinopathy
Pregnancy or breastfeeding
Pituitary disorders
Hypersensitivity to components

Quality Checklist

Good Signs

Third-party testing confirming both components
Certificate of Analysis with ratios verified
Reputable research supplier
Proper cold chain shipping

Warning Signs

Tesamorelin is FDA-approved as Egrifta – research blends are not
Ipamorelin remains investigational

Bad Signs

No Certificate of Analysis
Cannot verify Tesamorelin:Ipamorelin ratio
Discolored or particulate solution

Frequently Asked Questions

Why combine tesamorelin and ipamorelin instead of using them separately?

Tesamorelin and ipamorelin work on complementary GH-release pathways (GHRH vs GHRP receptors), producing synergistic GH release greater than either alone. The combination mimics natural pulsatile GH secretion more effectively while maintaining safety with less cortisol/prolactin elevation than GHRPs used solo.

What’s the ideal 5/5 vs 10/3 ratio for Tesa/IPA and when to use each?

5/5 (equal parts) provides balanced GH stimulation suitable for general recovery. The 10/3 (higher tesamorelin) variant emphasizes visceral fat loss and metabolic effects. Choose 5/5 for athletic recovery; 10/3 for fat-loss focused protocols with body composition optimization goals.

Should the Tesa/IPA blend be taken on an empty stomach?

Yes, both tesamorelin and ipamorelin work best on an empty stomach (2-3 hours before eating). Evening injection (before bed) on an empty stomach optimizes the protocol by aligning with natural nighttime GH pulses and avoiding food-induced metabolic interference.

Can Tesa/IPA be combined with CJC-1295 or other GH secretagogues?

No, combining Tesa/IPA (which already contains both GHRH and GHRP pathways) with additional GHRPs or GHRH analogs risks excessive pituitary stimulation. The blend is specifically designed as a complete dual-pathway system that shouldn’t require additional GH secretagogues.

References

Metabolic effects of a growth hormone-releasing factor in patients with HIV

Falutz J, Allas S, Blot K, et al.

New England Journal of Medicine (2007)

Landmark RCT in 412 HIV patients: tesamorelin 2 mg daily for 26 weeks reduced visceral fat by 10.9% vs 0.6% placebo, improved lipid profiles with no change in subcutaneous fat.
Ipamorelin, the first selective growth hormone secretagogue

Raun K, Hansen BS, Johansen NL, et al.

European Journal of Endocrinology (1998)

Ipamorelin is the first GHRP-receptor agonist with selectivity for GH release similar to GHRH; does not release ACTH or cortisol even at doses over 200-fold the ED50 for GH.
GHRH + GHRP Synergy

Endocrine Reviews

Combining GHRH and GHRP pathways produces synergistic GH release greater than either agent alone, driven by independent receptor mechanisms on pituitary somatotrophs.
No Published Studies on Tesa/IPA Combination

N/A (2024)

No clinical trials have evaluated the specific tesamorelin + ipamorelin blend; synergy is inferred from GHRH/GHRP pharmacology and individual component data.

Disclaimer

This information is for educational and research purposes only. Consult a healthcare professional before use.

PEPS MN / МЭДЛЭГИЙН САН

Tesamorelin (Egrifta SV)

FDA Approved

GHRH Analog | Visceral Fat Reduction

Weight: 5,135.9 Da

Half-life: 26-38 minutes

Chain: 44 amino acids

5 studies

2025 latest

2 recent

FDA Approved

Community Research

Join others researching Tesamorelin — share findings, ask questions, and learn from real experiences

View Results Aggregated community findings

Discussion Questions & experiences

Submit Your Findings Contribute your research data

Tesamorelin is an FDA-approved synthetic GHRH analog designed for HIV-associated lipodystrophy treatment. It provides selective visceral fat targeting with 15-20% visceral fat reduction in clinical trials while preserving subcutaneous fat.

Mechanism of Action

Subcutaneous injection provides optimal bioavailability for GHRH receptor binding and pulsatile GH release stimulation, selectively targeting visceral adipose tissue while sparing subcutaneous fat.

01 FDA-approved formulation

02 Selective visceral fat targeting (15-20% reduction)

03 Proven clinical efficacy

04 Standardized dosing

05 37% liver fat reduction in NAFLD

06 Preserved subcutaneous fat

Molecular Data

Molecular Weight

5,135.9 Da

Chain Length

44 amino acids

Type

GHRH analog

Amino Acid Sequence

One-letter: HADGIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

H₂N

H 1

O ‖ C

A 2

O ‖ C

D 3

O ‖ C

G 4

O ‖ C

I 5

O ‖ C

F 6

O ‖ C

T 7

O ‖ C

N 8

O ‖ C

S 9

O ‖ C

Y 10

O ‖ C

R 11

O ‖ C

K 12

O ‖ C

V 13

O ‖ C

L 14

O ‖ C

G 15

O ‖ C

Q 16

O ‖ C

L 17

O ‖ C

S 18

O ‖ C

A 19

O ‖ C

R 20

O ‖ C

K 21

O ‖ C

L 22

O ‖ C

L 23

O ‖ C

Q 24

O ‖ C

D 25

O ‖ C

I 26

O ‖ C

M 27

O ‖ C

S 28

O ‖ C

R 29

O ‖ C

Q 30

O ‖ C

Q 31

O ‖ C

G 32

O ‖ C

E 33

O ‖ C

S 34

O ‖ C

N 35

O ‖ C

Q 36

O ‖ C

E 37

O ‖ C

R 38

O ‖ C

G 39

O ‖ C

A 40

O ‖ C

R 41

O ‖ C

A 42

O ‖ C

R 43

O ‖ C

L 44

COOH

His

Ala

Asp

Gly

Ile

Phe

Thr

Asn

Ser

Tyr

Arg

Lys

Val

Leu

Gly

Gln

Leu

Ser

Ala

Arg

Lys

Leu

Gln

Asp

Ile

Met

Ser

Arg

Gln

Gly

Glu

Ser

Asn

Gln

Glu

Arg

Gly

Ala

Arg

Ala

Arg

Leu

N-terminus C-terminus

Hydrophobic

Polar

Positive (+)

Negative (-)

Modified

Research Indications

Weight Loss

HIV-Associated Lipodystrophy most effective

FDA-approved indication showing 15-20% visceral fat reduction in clinical trials.

Selective Visceral Fat Targeting most effective

Unique mechanism that reduces dangerous visceral fat while sparing subcutaneous fat.

Sustained Fat Loss effective

Maintained weight loss with continuous treatment over 52+ weeks in clinical studies.

Metabolic

Triglyceride Reduction effective

12.3% reduction in triglyceride levels.

Cholesterol Profile Improvement effective

7.2% improvement in cholesterol markers.

NAFLD Treatment effective

37% liver fat reduction over 12 months.

Body Composition

Lean Mass Preservation moderate

Preserves lean muscle mass during fat loss.

IGF-1 Elevation moderate

26% increase in IGF-1 levels.

Dosing Protocols

Subcutaneous injection to abdomen (avoid navel ±2 inches). Evening injection preferred for GH circadian rhythm alignment.

Goal	Dose	Frequency	Route
HIV Lipodystrophy (FDA-approved)	1.4mg	Once daily	SubQ
Visceral Fat Reduction	2mg	Once daily	SubQ
Anti-aging/Body Composition	1-2mg	5-7x weekly	SubQ
NAFLD Treatment	2mg	Once daily (12 months)	SubQ
Cognitive Enhancement	1mg	Once daily (20 weeks)	SubQ

Reconstitution Instructions

Materials Needed:

Tesamorelin lyophilized powder
Sterile water (Egrifta SV) or Bacteriostatic water (Egrifta WR)
Insulin syringes
Alcohol prep pads

1 Allow vial to reach room temperature
2 Egrifta SV: Add 0.5mL sterile water to 2mg vial – use immediately
3 Egrifta WR: Add 1.3mL bacteriostatic water to 11.6mg vial – stable 7 days
4 Gently swirl (don’t shake vigorously)
5 Withdraw appropriate dose (~0.35mL for 1.4mg)
6 Inject SubQ, rotating sites
7 Store reconstituted WR at room temperature up to 7 days

Interactions

Ipamorelin

Synergistic GH stimulation; monitor IGF-1 levels.

monitor

CJC-1295

Combined use may elevate IGF-1 supraphysiologically.

monitor

Sermorelin

Similar mechanism; risk of excessive effects at higher doses.

monitor

Insulin

3.3-fold diabetes risk increase; monitor glucose closely.

monitor

Metformin

May mitigate glucose intolerance associated with tesamorelin.

compatible

Prednisone

Decreases corticosteroid effectiveness.

monitor

Octreotide

Blocks GH release, negates tesamorelin effects.

avoid

Growth Hormone

Redundant; risk of acromegaly-like effects.

avoid

What to Expect

Week 1-2

IGF-1 levels begin to rise, possible mild water retention or joint discomfort

Week 4-6

Early metabolic changes; improved energy/sleep

Week 8-12

Visible visceral fat reduction begins, waist circumference may decrease

Week 12-26

Peak effects achieved with significant body composition improvements

Side Effects & Safety

Common Side Effects

Injection site reactions (17%)
Joint pain (13%)
Water retention

Stop Signs – Discontinue if:

Development of diabetes or severe glucose intolerance (HbA1c ≥6.5%)
Signs of malignancy
Severe hypersensitivity reactions
Excessive IGF-1 elevation (>2 SD above normal) with acromegaly symptoms

Contraindications

Active malignancy
Pituitary disorders
Pregnancy

Quality Checklist

Good Signs

FDA-approved formulations (Egrifta SV/WR from licensed pharmacy)
White crystalline powder (uniform, cake-like)
Clear reconstituted solution (colorless, no particles)
Proper packaging (sealed vials, intact stoppers)

Warning Signs

Compounded formulations may have quality/potency variability

Bad Signs

Discolored or cloudy solution (yellow/brown indicates degradation)
Visible particles or precipitate

Frequently Asked Questions

Does tesamorelin specifically target visceral fat or does it reduce overall body fat?

Tesamorelin uniquely targets visceral (deep abdominal) fat while sparing subcutaneous fat. This selective mechanism makes it FDA-approved specifically for HIV-associated lipodystrophy – the visceral fat reduction of 15-20% occurs without proportional subcutaneous fat loss, improving metabolic health and reducing cardiovascular risk.

Can tesamorelin improve cognitive function or is that just a side benefit?

Cognitive improvement isn’t a primary effect, but a Phase 2 trial in 152 older adults (55-87 years) showed favorable effects on cognition, particularly executive function (P=0.005), with 117% IGF-1 increases. This suggests potential anti-aging brain benefits, though larger trials are needed for confirmation.

Does tesamorelin increase diabetes risk like other GH therapies?

Yes, tesamorelin carries a documented 3.3-fold increased diabetes risk compared to placebo. Close glucose monitoring is essential, especially in pre-diabetic patients. Metformin co-treatment may mitigate this risk, and diabetics require careful medication adjustment.

Why use tesamorelin over semaglutide for visceral fat loss?

Tesamorelin uniquely spares subcutaneous fat while targeting visceral fat, making it better for patients wanting to preserve healthy fat deposits. Semaglutide causes general weight loss across all fat depots. Choose tesamorelin for selective visceral fat reduction in metabolically healthy individuals; semaglutide for comprehensive weight loss.

References

Metabolic Effects of a Growth Hormone-Releasing Factor in Patients with HIV (LIPO-010)

Falutz, J., et al.

New England Journal of Medicine (2007)

Pivotal Phase III trial in 412 HIV patients. Tesamorelin 2mg daily for 26 weeks significantly decreased visceral fat and improved lipid profiles compared to placebo.
Effects of Tesamorelin in HIV-Infected Patients with Abdominal Fat Accumulation: Randomized Placebo-Controlled Trial with Safety Extension (CTR-1011)

Falutz, J., et al.

Journal of Acquired Immune Deficiency Syndromes (2010)

404 HIV patients treated for up to 12 months. 69% achieved ≥8% VAT reduction vs 33% placebo. VAT benefits were lost upon discontinuation, confirming need for continuous therapy.
Effects of Growth Hormone-Releasing Hormone on Cognitive Function in Adults with MCI and Healthy Older Adults

Baker, L.D., et al.

Archives of Neurology (2012)

152 adults (ages 55-87) treated with tesamorelin 1mg daily for 20 weeks. Favorable effect on cognition (P=0.03), with particular benefit on executive function (P=0.005) and IGF-1 increase of 117%.
Effects of Tesamorelin on Non-Alcoholic Fatty Liver Disease in HIV: A Randomised, Double-Blind, Multicentre Trial

Stanley, T.L., et al.

Lancet HIV (2019)

61 HIV patients with NAFLD randomized to tesamorelin 2mg vs placebo for 12 months. 37% relative reduction in hepatic fat fraction (P=0.02), with prevention of fibrosis progression on liver biopsy.
Body Composition, Hepatic Fat, Metabolic, and Safety Outcomes of Tesamorelin: A Meta-Analysis of Randomized Controlled Trials

Elgenidy, A., et al.

HIV Medicine (2025)

Meta-analysis of 5 RCTs showing significant VAT reduction (MD=-27.71 cm², P<0.001), increased lean body mass (MD=1.42 kg, P<0.001), and improved hepatic fat and IGF-1 levels without serious safety concerns.

Disclaimer

This information is for educational and research purposes only. Consult a healthcare professional before use.

PEPS MN / МЭДЛЭГИЙН САН

CJC/IPA протокол (CJC-1295/Ipamorelin)

CJC/IPA Protocol (CJC-1295/Ipamorelin)

GHRH/GHRP Combination | Growth Hormone Optimization

Weight: N/A

Chain: N/A

4 studies

2006 latest

2 recent

Well Studied

Community Research

Join others researching CJC/IPA Protocol — share findings, ask questions, and learn from real experiences

View Results Aggregated community findings

Discussion Questions & experiences

Submit Your Findings Contribute your research data

A dual-pathway protocol combining CJC-1295 and Ipamorelin that targets growth hormone secretion through complementary mechanisms. CJC-1295 demonstrates 2-10 fold GH increases with 6-8 day duration, while Ipamorelin provides selective GH release without cortisol elevation.

Mechanism of Action

CJC-1295 activates GHRH receptors via albumin-binding DAC technology for sustained elevation. Ipamorelin selectively activates ghrelin receptors (GHSR1a) without affecting ACTH/cortisol, preserving natural pulsatile GH patterns.

01 Sustained GH elevation (6-8 days from CJC-1295)

02 Selective pulsatile release without cortisol suppression

03 Complementary dual-pathway optimization

04 Preservation of natural GH rhythm

05 Enhanced muscle protein synthesis and recovery

Molecular Data

Molecular Weight

N/A

Chain Length

N/A

Type

Peptide combination (GHRH analog + GHS)

Amino Acid Sequence

N/A

Complex or non-standard sequence format

Research Indications

Muscle Growth

Enhanced Protein Synthesis most effective

Growth hormone elevation supports muscle protein synthesis and nitrogen retention during training.

Improved Recovery most effective

Sustained GH patterns may accelerate muscle repair between exercise sessions.

Lean Mass Preservation most effective

GH optimization helps maintain muscle during caloric restriction or aging.

Metabolic Health

Body Composition Support effective

Growth hormone promotes lipolysis while supporting lean tissue maintenance.

Metabolic Flexibility effective

Enhanced GH patterns may improve glucose and fat utilization.

Anti-Aging

Sleep Quality Enhancement moderate

Evening GH peaks align with deeper, more restorative sleep patterns.

Tissue Regeneration moderate

Sustained GH elevation supports skin elasticity and connective tissue health.

Recovery

Accelerated Healing moderate

Growth hormone supports tissue repair and recovery from exercise or injury.

Joint Health moderate

Enhanced collagen synthesis supports joint and connective tissue integrity.

Dosing Protocols

Subcutaneous administration optimal for bioavailability; available as blended vials or separate formulations.

Goal	Dose	Frequency	Route
General Health Optimization	200mcg each (0.2mL if 1mg/mL)	Once daily	SubQ
Performance Enhancement	250mcg each (0.25mL if 1mg/mL)	Once daily	SubQ
Recovery Optimization	300mcg each (0.3mL if 1mg/mL)	Once daily	SubQ
Conservative Approach	150mcg each (0.15mL if 1mg/mL)	5 days per week	SubQ

Reconstitution Instructions

Materials Needed:

Bacteriostatic water (2-4mL)
Insulin syringes (0.3-1mL capacity)
Alcohol swabs for sterilization

1 BLENDED: Add 2mL bacteriostatic water to create ~2mg/mL concentration
2 SEPARATE: Add 2mL water to each vial for 1mg/mL per peptide
3 Draw 0.2-0.3mL for 200-300mcg dosing
4 Mix equal volumes or inject at different sites
5 Administer 2-3 hours post-meal, 30-60 minutes before bed
6 Rotate subcutaneous sites (abdomen, thigh, upper arm) daily

Interactions

MK-677

Both affect GH pathways; monitor for excessive GH elevation and insulin sensitivity changes.

monitor

BPC-157

No known interactions; different mechanisms (GH optimization vs. tissue repair signaling).

compatible

Insulin

GH affects insulin sensitivity; diabetic users require glucose monitoring and insulin adjustments.

monitor

Synthetic HGH

Redundant mechanisms may cause excessive GH suppression of natural pulsatile release.

avoid

Thyroid Medications

Space 4+ hours from GH secretagogues due to absorption and metabolic interactions.

monitor

Corticosteroids

May blunt GH response; higher doses or alternative timing may be necessary.

monitor

What to Expect

Week 1-2

Improved sleep depth and quality; increased dream vividness

Week 3-4

Enhanced exercise recovery; reduced muscle soreness; improved energy

Week 6-8

Gradual body composition changes; improved skin quality; general well-being

Week 8-12

Optimized benefits plateau; individual responses vary significantly

Post-Cycle

Benefits persist several weeks due to improved sleep and recovery patterns

Side Effects & Safety

Common Side Effects

Water retention and joint swelling
Carpal tunnel syndrome (numbness/tingling)
Mild blood glucose elevation
Injection site irritation with improper rotation

Stop Signs – Discontinue if:

Persistent joint pain or swelling indicating fluid retention
Significant blood glucose changes or diabetic control issues
Unusual fatigue, lethargy, or mood deterioration
Injection site infections or persistent reactions
Numbness or tingling in hands/feet
Signs of accelerated tumor growth if cancer history exists

Contraindications

Cancer history or active malignancy
Severe diabetes requiring tight glucose control
Carpal tunnel syndrome or nerve compression disorders

Quality Checklist

Good Signs

Standard format labeling: ’10mg total: 5mg CJC-1295 + 5mg Ipamorelin’
1:1 ratio maintenance between peptides for optimal effects
Clear reconstitution without particles or cloudiness
Certificate of Analysis with individual peptide purities
Proper cold chain with cold packs and immediate refrigeration

Warning Signs

Format selection: Beginners prefer separate vials for tolerance testing
Blended format offers convenience but limits dose adjustment
Combination protocols lack peer-reviewed clinical validation

Bad Signs

Damaged packaging or missing refrigeration
Heat exposure during shipping
Lack of Certificate of Analysis documentation

Frequently Asked Questions

Why do people combine CJC-1295 and Ipamorelin instead of using them separately?

CJC-1295 and Ipamorelin target GH secretion through complementary mechanisms—CJC-1295 activates GHRH receptors while Ipamorelin activates ghrelin receptors—creating synergistic effects greater than either peptide alone. Ipamorelin uniquely avoids cortisol elevation, making the combination particularly effective and tolerable.

Can I use the CJC/IPA protocol if I have a history of diabetes?

CJC/IPA combinations require caution with diabetes history due to GH’s insulin-antagonistic effects. Both peptides elevate growth hormone which can impair glucose tolerance. Medical supervision and regular blood glucose monitoring are essential before starting, especially with the continuous GH elevation this protocol provides.

What’s the advantage of Ipamorelin over GHRP-6 in this combination?

Ipamorelin is selective for GH release and does NOT elevate cortisol or prolactin even at high doses, whereas GHRP-6 causes significant appetite stimulation and potential cortisol elevation. For the CJC/IPA protocol, Ipamorelin provides cleaner GH stimulation without the side effects of broader GHRP peptides.

Should CJC/IPA be dosed together in the same injection or separately?

Both approaches work—some use blended vials containing both peptides at a 1:1 ratio, while others inject separately at the same or different sites. Blended vials offer convenience but allow less flexibility to adjust individual peptide doses, while separate vials let you customize ratios if needed.

References

Prolonged stimulation of growth hormone (GH) and insulin-like growth factor I secretion by CJC-1295, a long-acting analog of GH-releasing hormone, in healthy adults

Teichman SL, Neale A, Lawrence B, et al.

Journal of Clinical Endocrinology & Metabolism (2006)

Single CJC-1295 injection produced dose-dependent 2-10 fold GH increases for 6+ days and 1.5-3 fold IGF-1 increases for 9-11 days; estimated half-life 5.8-8.1 days.
Ipamorelin, the first selective growth hormone secretagogue

Raun K, Hansen BS, Johansen NL, et al.

European Journal of Endocrinology (1998)

Ipamorelin is the first GHRP-receptor agonist with selectivity for GH release similar to GHRH; does not release ACTH or cortisol even at doses over 200-fold the ED50 for GH.
Pulsatile secretion of growth hormone (GH) persists during continuous stimulation by CJC-1295, a long-acting GH-releasing hormone analog

Ionescu M, Frohman LA

Journal of Clinical Endocrinology & Metabolism (2006)

CJC-1295 preserves pulsatile GH secretion with unaltered pulse frequency and magnitude; basal GH levels increased 7.5-fold, mean GH 46%, and IGF-1 45%.
Ghrelin and growth hormone secretagogues potentiate GH-releasing hormone-induced cAMP production in cells expressing transfected GHRH and GH secretagogue receptors

Cunha SR, Mayo KE

Endocrinology (2002)

GHS potentiate GHRH-induced cAMP in a dose-dependent manner requiring co-expression of both receptors, providing the cellular basis for GHRH/GHRP synergy.

Disclaimer

This information is for educational and research purposes only. Consult a healthcare professional before use.

PEPS MN / МЭДЛЭГИЙН САН

GHRP-2 (Pralmorelin)

Growth Hormone Releasing Peptide-2 | Pralmorelin

Weight: 817.9 Da

Half-life: ~30 minutes

Chain: 6 amino acids

3 studies

2017 latest

Well Studied

Community Research

Join others researching GHRP-2 — share findings, ask questions, and learn from real experiences

View Results Aggregated community findings

Discussion Questions & experiences

Submit Your Findings Contribute your research data

GHRP-2 is a synthetic growth hormone secretagogue that stimulates the pituitary gland to release growth hormone. It is one of the most potent members of the GHRP family, being 2-3 times more effective than GHRP-6 in stimulating GH release. Originally developed as a diagnostic agent for growth hormone deficiency, it works by mimicking ghrelin and binding to the GHS-R1a receptor.

Mechanism of Action

GHRP-2 acts as a synthetic agonist of ghrelin, binding to the growth hormone secretagogue receptor (GHS-R1a) in the hypothalamus and pituitary. This stimulates cAMP production and promotes pulsatile release of endogenous growth hormone without suppressing natural feedback loops. It works synergistically with GHRH to amplify GH secretion beyond what either peptide achieves alone.

01 Potent stimulation of natural growth hormone release

02 Enhanced muscle growth and recovery

03 Improved body composition and fat metabolism

04 Better sleep quality and recovery

05 Increased appetite (can be beneficial for bulking)

06 Maintains natural GH pulsatile release patterns

07 Synergistic effects when combined with GHRH peptides

Molecular Data

Molecular Weight

817.9 Da

Chain Length

6 amino acids

Type

Synthetic hexapeptide

Amino Acid Sequence

One-letter: ?A??AW?FK?

H₂N

? 1

O ‖ C

A 2

O ‖ C

? 3

O ‖ C

? 4

O ‖ C

A 5

O ‖ C

W 6

O ‖ C

? 7

O ‖ C

F 8

O ‖ C

K 9

O ‖ C

? 10

COOH

Ala

2Na

Ala

Trp

Phe

Lys

NH2

N-terminus C-terminus

Hydrophobic

Polar

Positive (+)

Negative (-)

Modified

Research Indications

Growth Hormone Enhancement

GH Deficiency Assessment most effective

Used as a diagnostic agent in Japan for assessing growth hormone deficiency in clinical settings.

Natural GH Stimulation most effective

Stimulates endogenous growth hormone release through ghrelin receptor activation.

IGF-1 Elevation effective

Indirectly increases IGF-1 levels through enhanced GH secretion.

Body Composition

Muscle Growth effective

Enhanced muscle protein synthesis through elevated growth hormone and IGF-1 levels.

Fat Metabolism effective

Improved lipolysis and body composition through GH-mediated fat oxidation.

Recovery Enhancement effective

Faster recovery from exercise and improved sleep quality.

Protective Effects

Muscle Protection moderate

Myoprotective effects in muscle atrophy models through GHS-R1a stimulation.

Cardioprotection moderate

Cytoprotective effects observed in cardiac tissue research.

Dosing Protocols

Subcutaneous injection is the primary administration route. Best administered on an empty stomach for optimal GH release. Multiple daily doses recommended to maintain elevated GH levels.

Goal	Dose	Frequency	Route
GH optimization	100-150 mcg	2-3x daily	SubQ
Enhanced results	200-300 mcg	2-3x daily	SubQ
With GHRH (synergy)	100 mcg each	2-3x daily	SubQ (combined)
Pre-sleep protocol	100-200 mcg	Before bed	SubQ

Reconstitution Instructions

Materials Needed:

Bacteriostatic water (BAC)
Insulin syringes (0.5-1 mL)
Alcohol swabs
Peptide vial
Sterile work surface

1 Clean work area and hands thoroughly
2 Calculate required BAC water volume
3 Draw BAC water into syringe
4 Inject slowly down vial side (not directly onto powder)
5 Gently swirl until dissolved (never shake)
6 Store in refrigerator, use within 28 days

Interactions

CJC-1295

Powerful synergy; GHRH + GHRP combination amplifies GH release significantly.

synergistic

Mod GRF 1-29

Classic GHRP + GHRH stack for enhanced growth hormone release.

synergistic

Ipamorelin

Both are GHRPs; can be alternated but typically not stacked together.

compatible

GHRP-6

Similar mechanism; GHRP-2 is more potent with less appetite stimulation.

compatible

BPC-157

No known negative interactions; different mechanisms.

compatible

What to Expect

Immediately

GH spike within 15-30 minutes of injection

Week 1-2

Improved sleep quality and recovery

Week 2-4

Noticeable improvements in energy and well-being

Week 4-8

Visible changes in body composition and muscle fullness

Week 8-12

Full benefits realized with consistent use

Side Effects & Safety

Common Side Effects

Increased appetite (less than GHRP-6)
Mild water retention
Tingling or numbness in extremities
Tiredness or lethargy after injection
Mild headache

Stop Signs – Discontinue if:

Severe or persistent headaches
Unusual swelling in hands or feet
Signs of carpal tunnel syndrome
Allergic reactions

Contraindications

Active cancer or history of cancer
Pregnancy or breastfeeding
Pituitary disorders
Diabetic retinopathy
WADA prohibited for competitive athletes

Quality Checklist

Good Signs

White to off-white lyophilized powder
Clear solution after reconstitution
Intact vacuum seal on vial

Warning Signs

Slight clumping that dissolves easily

Bad Signs

Discolored or yellow powder
Cloudy solution after reconstitution
Particles or precipitates in solution

Frequently Asked Questions

Is GHRP-2 stronger than GHRP-6 for stimulating growth hormone?

Yes, GHRP-2 is 2-3 times more potent than GHRP-6 at stimulating GH release. However, GHRP-2 causes less appetite stimulation than GHRP-6, making it more tolerable for those sensitive to hunger effects. The trade-off is strength versus side effects—GHRP-2 is more powerful with fewer appetite issues.

How much should I dose GHRP-2 with an empty stomach requirement?

Standard GHRP-2 dosing is 100-300mcg, 2-3 times daily on a completely empty stomach (2+ hours after eating). Wait 30 minutes after injection before consuming food to optimize GH release. Best timing is morning upon waking, post-workout, and bedtime when natural GH is already elevated.

Will GHRP-2 cause elevated cortisol like some sources suggest?

At recommended doses (100-300mcg), GHRP-2 rarely elevates cortisol significantly. However, very high doses (>300mcg) or frequent dosing can increase cortisol. Most side effects are manageable water retention and appetite, with cortisol elevation primarily a concern with dose escalation beyond therapeutic ranges.

Can I use GHRP-2 if I’m diabetic or glucose-sensitive?

GHRP-2 can modestly affect glucose metabolism through GH’s insulin-antagonistic effects. Diabetic users require careful monitoring and possible insulin adjustment. For glucose-sensitive individuals, monitor blood sugar before, during, and after use. Medical supervision is recommended, particularly with insulin-dependent diabetes.

References

Growth Hormone Releasing Peptide-2 increases food intake in healthy men

Journal of Clinical Endocrinology & Metabolism (2010)

GHRP-2 infusion increased food intake by 35.9% compared to saline, demonstrating ghrelin-like orexigenic effects.
Synthetic Growth Hormone-Releasing Peptides: Cytoprotective Effects

Clinical Medicine Insights: Cardiology (2017)

GHRPs including GHRP-2 demonstrated significant cytoprotective effects in cardiac and extracardiac tissues.
GHRP-2 effects on growth hormone release in swine

Domestic Animal Endocrinology (2000)

Chronic GHRP-2 administration increased average daily gain by 22.35% and feed efficiency by 20.64%.

Disclaimer

This information is for educational and research purposes only. Consult a healthcare professional before use.

PEPS MN / МЭДЛЭГИЙН САН

GHRP-6 (Growth Hormone Releasing Hexapeptide)

Growth Hormone Releasing Peptide-6 | Hexapeptide GHS

Weight: 873 Da

Half-life: 15-60 minutes

Chain: 6 amino acids

3 studies

2017 latest

Well Studied

Community Research

Join others researching GHRP-6 — share findings, ask questions, and learn from real experiences

View Results Aggregated community findings

Discussion Questions & experiences

Submit Your Findings Contribute your research data

GHRP-6 is a synthetic growth hormone secretagogue that stimulates the pituitary gland to release growth hormone. It was one of the first GHRPs developed and works by binding to the ghrelin receptor (GHS-R1a). Unlike direct HGH injections, GHRP-6 enhances the body’s natural GH production while keeping negative feedback mechanisms balanced. It is known for its potent appetite-stimulating effects.

Mechanism of Action

GHRP-6 binds to the growth hormone secretagogue receptor (GHS-R1a), the same receptor activated by ghrelin. This initiates a signaling cascade in the hypothalamus and pituitary gland, triggering a rapid pulse of natural GH secretion. The released GH then signals the liver to secrete IGF-1, which promotes muscle growth and fat metabolism. GHRP-6 also stimulates ghrelin release, causing significant appetite increase.

01 Potent stimulation of natural growth hormone release

02 Significant increase in appetite (beneficial for bulking/weight gain)

03 Enhanced muscle growth through elevated GH and IGF-1

04 Improved fat metabolism and body composition

05 Cardioprotective effects observed in research

06 Enhanced recovery from exercise and injury

07 Cytoprotective and anti-inflammatory properties

08 Maintains natural GH pulsatile release

Molecular Data

Molecular Weight

873 Da

Chain Length

6 amino acids

Type

Synthetic hexapeptide

Amino Acid Sequence

One-letter: H?WAW?FK?

H₂N

H 1

O ‖ C

? 2

O ‖ C

W 3

O ‖ C

A 4

O ‖ C

W 5

O ‖ C

? 6

O ‖ C

F 7

O ‖ C

K 8

O ‖ C

? 9

COOH

His

Trp

Ala

Trp

Phe

Lys

NH2

N-terminus C-terminus

Hydrophobic

Polar

Positive (+)

Negative (-)

Modified

Research Indications

Growth Hormone Enhancement

GH Secretion most effective

Potent stimulation of endogenous growth hormone release through ghrelin receptor activation.

IGF-1 Elevation effective

Indirectly increases IGF-1 levels through enhanced GH secretion from the pituitary.

Body Composition

Muscle Growth effective

Enhanced muscle protein synthesis through elevated growth hormone and IGF-1 levels.

Appetite Stimulation most effective

Significant increase in hunger through ghrelin pathway activation, beneficial for those needing to gain weight.

Recovery Enhancement effective

Faster recovery from exercise and improved tissue repair.

Protective Effects

Cardioprotection moderate

Research indicates protective effects on cardiac tissue independent of GH release.

Cytoprotection moderate

Systemic cytoprotective effects with anti-inflammatory properties observed in liver and other organs.

Antioxidant Effects moderate

Attenuation of reactive oxygen species and preservation of antioxidant defenses.

Dosing Protocols

Subcutaneous injection is the primary administration route. Must be administered on an empty stomach as elevated blood glucose or insulin significantly blunts GH release. Multiple daily doses recommended.

Goal	Dose	Frequency	Route
GH optimization	100 mcg	2-3x daily	SubQ
Enhanced results	200-300 mcg	2-3x daily	SubQ
With GHRH (synergy)	100 mcg each	2-3x daily	SubQ (combined)
Appetite/bulking	100-200 mcg	Before meals	SubQ

Reconstitution Instructions

Materials Needed:

Bacteriostatic water (BAC)
Insulin syringes (0.5-1 mL)
Alcohol swabs
Peptide vial
Sterile work surface

1 Clean work area and hands thoroughly
2 Calculate required BAC water volume
3 Draw BAC water into syringe
4 Inject slowly down vial side (not directly onto powder)
5 Gently swirl until dissolved (never shake)
6 Store in refrigerator, use within 28 days

Interactions

CJC-1295

GHRH + GHRP combination produces synergistic GH release significantly greater than either alone.

synergistic

Mod GRF 1-29

Classic stack; GHRH amplifies GHRP-6’s effects on growth hormone release.

synergistic

GHRP-2

Similar mechanism; GHRP-2 is more potent with less appetite stimulation.

compatible

Ipamorelin

Both are GHRPs; Ipamorelin has fewer side effects but is less potent.

compatible

BPC-157

No known negative interactions; often combined for recovery protocols.

compatible

Insulin

Simultaneous administration may increase GH response, but carb consumption blunts GH release.

requires timing

What to Expect

Immediately

Intense hunger within 15-20 minutes; GH spike within 30 minutes

Week 1-2

Improved sleep quality and increased appetite

Week 2-4

Enhanced recovery and energy levels

Week 4-8

Noticeable changes in body composition

Week 8-12

Full benefits with improved muscle fullness and fat loss

Side Effects & Safety

Common Side Effects

Intense hunger/increased appetite (most notable side effect)
Water retention
Tingling or numbness in extremities
Tiredness or lethargy after injection
Mild headache

Stop Signs – Discontinue if:

Severe or persistent headaches
Unusual swelling in hands or feet
Signs of carpal tunnel syndrome
Allergic reactions
Hypoglycemia symptoms

Contraindications

Active cancer or history of cancer
Pregnancy or breastfeeding
Pituitary disorders
Diabetes (use with caution)
WADA prohibited for competitive athletes

Quality Checklist

Good Signs

White to off-white lyophilized powder
Clear solution after reconstitution
Intact vacuum seal on vial

Warning Signs

Slight clumping that dissolves with gentle swirling

Bad Signs

Discolored or yellow powder
Cloudy solution after reconstitution
Particles or precipitates in solution

Frequently Asked Questions

Why does GHRP-6 cause intense hunger while GHRP-2 doesn’t?

GHRP-6 potently stimulates ghrelin release (the ‘hunger hormone’) in addition to GH stimulation, whereas GHRP-2 is more selective for GH with minimal ghrelin elevation. This difference in receptor selectivity makes GHRP-6 cause profound appetite increase 15-20 minutes post-injection, while GHRP-2 is significantly less orexigenic.

Is GHRP-6 better for bulking because of the appetite increase?

Yes, GHRP-6’s appetite stimulation can be beneficial for bulking phases where consuming excess calories is the goal. The intense hunger makes eating surplus calories easier. For cutting phases, GHRP-2 is preferable to avoid fighting appetite stimulation, making peptide selection cycle-dependent.

How soon after GHRP-6 injection will I feel hungry?

Hunger typically begins within 15-20 minutes of subcutaneous GHRP-6 injection and peaks around 30-45 minutes post-injection. It can be quite intense, making meal timing important. Planning to eat 20-30 minutes after injection aligns appetite peak with eating windows.

Can I stack GHRP-6 with CJC-1295 for maximum GH release?

Yes, GHRP-6 stacked with CJC-1295 creates powerful synergy—GHRH + GHRP combination releases significantly more GH than either alone. This is the classic ‘stack’ for maximizing growth hormone, though it requires careful dosing to avoid excessive IGF-1 elevation and managing combined side effects like water retention and joint stress.

References

Effects of GHRP-6 on Weight Gain and Fat Mass

Endocrinology (2010)

Significant differences in body composition, muscle growth, glucose metabolism, memory and cardiac function in mice administered GHRP-6.
Synthetic Growth Hormone-Releasing Peptides: Cytoprotective Effects

Clinical Medicine Insights: Cardiology (2017)

GHRP-6 demonstrated systemic cytoprotective effects, anti-inflammatory properties, and cardioprotective effects in multiple studies.
GHRP-6 Clinical Safety Trial

Clinical Research (2015)

Intravenous administration proved safe in dose scale-up clinical trial in healthy human volunteers.

Disclaimer

This information is for educational and research purposes only. Consult a healthcare professional before use.

PEPS MN / МЭДЛЭГИЙН САН

Hexarelin (Examorelin)

Examorelin | Synthetic Growth Hormone Secretagogue

Weight: 887 Da

Half-life: 1-2 hours

Chain: 6 amino acids

4 studies

2017 latest

Well Studied

Community Research

Join others researching Hexarelin — share findings, ask questions, and learn from real experiences

View Results Aggregated community findings

Discussion Questions & experiences

Submit Your Findings Contribute your research data

Hexarelin is one of the most potent synthetic growth hormone secretagogues available. It stimulates GH release by binding to the GHS-R1a receptor in the pituitary and hypothalamus, mimicking the action of ghrelin. Notably, Hexarelin demonstrates synergistic effects when combined with GHRH, producing GH responses greater than the arithmetic sum of either peptide alone. It also shows unique cardioprotective properties mediated through the CD36 receptor.

Mechanism of Action

Hexarelin binds to the growth hormone secretagogue receptor 1a (GHS-R1a) in the brain and pituitary gland. This binding initiates a signaling cascade that stimulates somatotroph cells in the anterior pituitary to produce and release growth hormone. Hexarelin also has slight, dose-dependent effects on prolactin, ACTH, and cortisol release. Its cardioprotective effects are mediated through CD36 receptor activation and modulation of calcium channels in cardiomyocytes.

01 Most potent GHRP for GH stimulation

02 Powerful synergy with GHRH peptides

03 Cardioprotective effects via CD36 receptor

04 Enhanced muscle growth and strength

05 Improved fat metabolism

06 Better recovery and tissue repair

07 Maintains natural GH pulsatility

08 Stable against proteolytic enzymes

Molecular Data

Molecular Weight

887 Da

Chain Length

6 amino acids

Type

Synthetic hexapeptide

Amino Acid Sequence

One-letter: H???WAW?FK?

H₂N

H 1

O ‖ C

? 2

O ‖ C

? 3

O ‖ C

? 4

O ‖ C

W 5

O ‖ C

A 6

O ‖ C

W 7

O ‖ C

? 8

O ‖ C

F 9

O ‖ C

K 10

O ‖ C

? 11

COOH

His

met

Trp

Ala

Trp

Phe

Lys

NH2

N-terminus C-terminus

Hydrophobic

Polar

Positive (+)

Negative (-)

Modified

Research Indications

Growth Hormone Enhancement

GH Secretion most effective

Most potent GHRP for stimulating endogenous growth hormone release from the pituitary.

Synergy with GHRH most effective

Produces synergistic GH release when combined with GHRH, greater than sum of individual effects.

IGF-1 Elevation effective

Significant increases in IGF-1 levels through enhanced GH secretion.

Cardiovascular

Cardioprotection effective

Protective effects on cardiac tissue mediated through CD36 receptor activation.

Cardiomyocyte Protection moderate

Reduces apoptosis of cardiomyocytes and controls cardiac action potential.

Calcium Channel Modulation moderate

Cardiotropic effects mediated by elevation of Ca2+ influx through voltage-gated calcium channels.

Metabolic

Fat Metabolism effective

Beneficial effects on lipid metabolism via CD36 receptor in non-obese insulin-resistant models.

Body Composition effective

Improved lean mass to fat ratio through GH and IGF-1 elevation.

Dosing Protocols

Subcutaneous or intramuscular injection. Hexarelin is rapidly absorbed after subcutaneous administration and demonstrates stability against proteolytic enzymes. Best administered on empty stomach.

Goal	Dose	Frequency	Route
GH optimization	100 mcg	2-3x daily	SubQ or IM
Enhanced results	200 mcg	2-3x daily	SubQ or IM
With GHRH (synergy)	100 mcg each	2-3x daily	SubQ (combined)
Cardioprotection	100-200 mcg	1-2x daily	SubQ

Reconstitution Instructions

Materials Needed:

Bacteriostatic water (BAC)
Insulin syringes (0.5-1 mL)
Alcohol swabs
Peptide vial
Sterile work surface

1 Clean work area and hands thoroughly
2 Calculate required BAC water volume
3 Draw BAC water into syringe
4 Inject slowly down vial side (not directly onto powder)
5 Gently swirl until dissolved (never shake)
6 Store in refrigerator, use within 28 days

Interactions

CJC-1295

Powerful synergy; combination produces GH response greater than sum of individual effects.

synergistic

GHRH 1-29

Research confirms synergistic GH release when co-administered.

synergistic

GHRP-2

Similar mechanism; typically not stacked together but can be alternated.

compatible

GHRP-6

Same receptor target; Hexarelin is more potent with less appetite stimulation.

compatible

Ipamorelin

Both are GHRPs; Hexarelin is more potent but may have more side effects.

compatible

What to Expect

Immediately

GH spike within 15-30 minutes of injection

Week 1-2

Improved sleep quality and recovery

Week 2-4

Enhanced energy and well-being

Week 4-8

Noticeable improvements in body composition

Week 8-12

Maximum benefits; consider cycling to prevent desensitization

Side Effects & Safety

Common Side Effects

Increased appetite (less than GHRP-6)
Water retention
Tingling or numbness
Tiredness after injection
Mild headache

Stop Signs – Discontinue if:

Severe or persistent headaches
Unusual swelling
Signs of carpal tunnel syndrome
Allergic reactions

Contraindications

Active cancer or history of cancer
Pregnancy or breastfeeding
Pituitary disorders
WADA prohibited for competitive athletes

Quality Checklist

Good Signs

White to off-white lyophilized powder
Clear solution after reconstitution
Intact vacuum seal on vial

Warning Signs

Slight clumping that dissolves easily

Bad Signs

Discolored or yellow powder
Cloudy solution after reconstitution
Particles or precipitates in solution

Frequently Asked Questions

Does hexarelin work better when combined with GHRH?

Yes. Hexarelin demonstrates synergistic effects with GHRH peptides like CJC-1295, producing GH responses greater than the sum of either peptide alone. This synergy is well-documented in research and is why the combination is popular among users seeking maximum GH elevation.

How long do the effects of hexarelin last?

Hexarelin has a half-life of approximately 75 minutes to 2 hours. This means you’ll see a GH spike within 15-30 minutes of injection, peaking around 30-60 minutes, then returning toward baseline. Multiple daily injections are needed to maintain elevated GH levels throughout the day.

Does hexarelin cause the same appetite stimulation as GHRP-6?

No. Hexarelin is significantly more potent for GH release while causing less appetite stimulation than GHRP-6. This makes it preferable if you want strong GH effects without the intense hunger that GHRP-6 typically triggers.

Can I take hexarelin on an empty stomach?

Yes, and you should. Hexarelin is most effective when injected on an empty stomach, ideally 30-60 minutes before eating. Food can interfere with GH release by elevating insulin levels and suppressing ghrelin signaling.

References

Hexarelin Improves Lipid Metabolic Aberrations in Insulin-Resistant Mice

Endocrinology (2017)

Hexarelin treatment improved lipid metabolism via CD36 receptor in non-obese insulin-resistant MKR mice.
Effect of Repeated Hexarelin Administration on GH Responsivity

European Journal of Endocrinology (1996)

Demonstrated synergistic GH response when hexarelin co-administered with GHRH, greater than arithmetic sum.
Hexarelin Modulates GHS-R1a Expression

Neuroendocrinology (2004)

Hexarelin significantly increased pituitary and hypothalamic GHS-R1a mRNA levels.
Kinetics and Disposition of Hexarelin in Rats

Drug Metabolism and Disposition (1999)

Half-life of 75.9 min; rapidly absorbed subcutaneously; stable against proteolytic enzymes.

Disclaimer

This information is for educational and research purposes only. Consult a healthcare professional before use.

MGF (Mechano Growth Factor)

MGF (Mechano Growth Factor)

Community Research

Molecular Data

Research Indications

Dosing Protocols

Reconstitution Instructions

Interactions

What to Expect

Side Effects & Safety

Common Side Effects

Stop Signs – Discontinue if:

Contraindications

Quality Checklist

Good Signs

Warning Signs

Bad Signs

Frequently Asked Questions

Why is MGF injected directly into muscles post-workout?

How is MGF different from PEG-MGF?

Can MGF cause hypoglycemia?

How long do I need to use MGF to see muscle growth?

References

Related Peptides

Disclaimer

MK-677 (Ibutamoren)

MK-677 (Ibutamoren)

Community Research

Molecular Data

Research Indications

Dosing Protocols

Interactions

What to Expect

Side Effects & Safety

Common Side Effects

Stop Signs – Discontinue if:

Contraindications

Quality Checklist

Good Signs

Warning Signs

Bad Signs

Frequently Asked Questions

Why is MK-677 oral when most peptides are injected?

Does MK-677 increase testosterone suppression when combined with SARMs?

How much does MK-677 increase appetite?

Does MK-677 cause water retention?

References

Related Peptides

Disclaimer

PEG-MGF (Pegylated MGF)

PEG-MGF (Pegylated MGF)

Community Research

Molecular Data

Research Indications

Dosing Protocols

Reconstitution Instructions

Interactions

What to Expect

Side Effects & Safety

Common Side Effects

Stop Signs – Discontinue if:

Contraindications

Quality Checklist

Good Signs

Warning Signs

Bad Signs

Frequently Asked Questions

What makes PEG-MGF better than regular MGF for muscle recovery?

Should I inject PEG-MGF into the muscle I just trained?

Can I stack PEG-MGF with testosterone for better muscle growth?

Does PEG-MGF work for non-athletes wanting muscle maintenance?

References

Related Peptides

Disclaimer

Sermorelin (Sermorelin acetate)

Sermorelin (Sermorelin acetate)

Community Research

Molecular Data

Research Indications

Dosing Protocols